BLASTX nr result
ID: Gardenia21_contig00045612
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00045612 (273 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO97647.1| unnamed protein product [Coffea canephora] 82 3e-19 >emb|CDO97647.1| unnamed protein product [Coffea canephora] Length = 1496 Score = 82.4 bits (202), Expect(3) = 3e-19 Identities = 36/52 (69%), Positives = 41/52 (78%) Frame = +2 Query: 104 MPANTTKLISTIWHKYCTKYLPKDVKCEDAEELQEKKNMFYENFKKLYCIAK 259 MPA TTKLIS IWHKYC+KYLP+D ED E LQE K++F ENFKK YC+ K Sbjct: 579 MPATTTKLISRIWHKYCSKYLPEDFNYEDTEALQETKSIFDENFKKFYCVPK 630 Score = 30.0 bits (66), Expect(3) = 3e-19 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = +1 Query: 49 RKKMFSRQKEHVHLEAAV 102 +KK+F QKEHV+LEAAV Sbjct: 552 KKKIFPSQKEHVNLEAAV 569 Score = 28.9 bits (63), Expect(3) = 3e-19 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = +3 Query: 6 LRDNLKELNRINLVKKE 56 LRDNLKEL+R LVKK+ Sbjct: 538 LRDNLKELHRTKLVKKK 554