BLASTX nr result
ID: Gardenia21_contig00045029
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00045029 (278 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO97168.1| unnamed protein product [Coffea canephora] 141 2e-31 >emb|CDO97168.1| unnamed protein product [Coffea canephora] Length = 928 Score = 141 bits (356), Expect = 2e-31 Identities = 71/92 (77%), Positives = 77/92 (83%) Frame = -1 Query: 278 VPLETTERSNTEEAGPKNQLNTKENIFHKSTLASQNQAPFPLPSTNVVQYRSRLSNPFKH 99 VPLE+ RSNTEE PKN LN+KEN FHKSTL+SQNQAPFPL STNVVQYRSRLSNPFK Sbjct: 823 VPLESAVRSNTEEGHPKNLLNSKENFFHKSTLSSQNQAPFPLLSTNVVQYRSRLSNPFKR 882 Query: 98 LLKPQTNLVRPSEGVKLVALKHKISPGNQLPQ 3 L KP +VR SEGV +VAL+HKISP NQLPQ Sbjct: 883 LQKPPAKVVRTSEGVTVVALEHKISPRNQLPQ 914