BLASTX nr result
ID: Gardenia21_contig00045017
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00045017 (320 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP03992.1| unnamed protein product [Coffea canephora] 61 4e-07 >emb|CDP03992.1| unnamed protein product [Coffea canephora] Length = 619 Score = 60.8 bits (146), Expect = 4e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -2 Query: 112 PSSRQREVIACSFRRHVCDCLHLLSMRIAGITYFRI 5 PSSRQREVIAC F RHVCDCLHLLS+RI I Y ++ Sbjct: 26 PSSRQREVIACGFGRHVCDCLHLLSVRIVLIVYLQV 61