BLASTX nr result
ID: Gardenia21_contig00044904
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00044904 (361 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP03040.1| unnamed protein product [Coffea canephora] 81 4e-13 ref|XP_006349977.1| PREDICTED: respiratory burst oxidase homolog... 75 3e-11 gb|AKS03955.1| respiratory burst oxidase-like protein 2, partial... 74 3e-11 ref|XP_004239582.1| PREDICTED: respiratory burst oxidase homolog... 74 3e-11 ref|XP_010103077.1| Respiratory burst oxidase-like protein E [Mo... 74 4e-11 ref|XP_010323982.1| PREDICTED: respiratory burst oxidase homolog... 74 4e-11 ref|XP_010323981.1| PREDICTED: respiratory burst oxidase homolog... 74 4e-11 ref|XP_009799187.1| PREDICTED: respiratory burst oxidase homolog... 73 1e-10 ref|XP_009609858.1| PREDICTED: respiratory burst oxidase homolog... 73 1e-10 ref|XP_009359699.1| PREDICTED: respiratory burst oxidase homolog... 73 1e-10 ref|XP_008242282.1| PREDICTED: respiratory burst oxidase homolog... 73 1e-10 ref|XP_006353773.1| PREDICTED: respiratory burst oxidase homolog... 73 1e-10 ref|XP_006353772.1| PREDICTED: respiratory burst oxidase homolog... 73 1e-10 ref|XP_007203796.1| hypothetical protein PRUPE_ppa001114mg [Prun... 73 1e-10 gb|KDO73805.1| hypothetical protein CISIN_1g0028301mg, partial [... 72 1e-10 ref|XP_006474684.1| PREDICTED: respiratory burst oxidase homolog... 72 1e-10 ref|XP_006452870.1| hypothetical protein CICLE_v10007394mg [Citr... 72 1e-10 ref|XP_011078139.1| PREDICTED: LOW QUALITY PROTEIN: respiratory ... 72 2e-10 ref|XP_009769453.1| PREDICTED: respiratory burst oxidase homolog... 72 2e-10 ref|XP_009618954.1| PREDICTED: respiratory burst oxidase homolog... 72 2e-10 >emb|CDP03040.1| unnamed protein product [Coffea canephora] Length = 924 Score = 80.9 bits (198), Expect = 4e-13 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = +3 Query: 87 KRSYHFTGVFYCGTPVLAKELKNLSHELTYKTSTRFEFHKEYF 215 K Y GVFYCG PVLAKELKNLSHELTYKTSTRFEFHKEYF Sbjct: 882 KHPYSTVGVFYCGMPVLAKELKNLSHELTYKTSTRFEFHKEYF 924 >ref|XP_006349977.1| PREDICTED: respiratory burst oxidase homolog protein E-like [Solanum tuberosum] Length = 892 Score = 74.7 bits (182), Expect = 3e-11 Identities = 34/43 (79%), Positives = 35/43 (81%) Frame = +3 Query: 87 KRSYHFTGVFYCGTPVLAKELKNLSHELTYKTSTRFEFHKEYF 215 K Y GVFYCG PVLAKELK +S ELTYKTSTRFEFHKEYF Sbjct: 850 KHPYSTVGVFYCGMPVLAKELKKISQELTYKTSTRFEFHKEYF 892 >gb|AKS03955.1| respiratory burst oxidase-like protein 2, partial [Rubia cordifolia] Length = 634 Score = 74.3 bits (181), Expect = 3e-11 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = +3 Query: 108 GVFYCGTPVLAKELKNLSHELTYKTSTRFEFHKEYF 215 GVFYCG PVLAKELK LSHELTYKTSTRF+FHKEYF Sbjct: 599 GVFYCGMPVLAKELKKLSHELTYKTSTRFDFHKEYF 634 >ref|XP_004239582.1| PREDICTED: respiratory burst oxidase homolog protein E-like [Solanum lycopersicum] Length = 880 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/43 (79%), Positives = 35/43 (81%) Frame = +3 Query: 87 KRSYHFTGVFYCGTPVLAKELKNLSHELTYKTSTRFEFHKEYF 215 K Y GVFYCG PVLAKELK LS E+TYKTSTRFEFHKEYF Sbjct: 838 KHPYSTVGVFYCGMPVLAKELKKLSQEVTYKTSTRFEFHKEYF 880 >ref|XP_010103077.1| Respiratory burst oxidase-like protein E [Morus notabilis] gi|587906704|gb|EXB94755.1| Respiratory burst oxidase-like protein E [Morus notabilis] Length = 919 Score = 73.9 bits (180), Expect = 4e-11 Identities = 33/43 (76%), Positives = 36/43 (83%) Frame = +3 Query: 87 KRSYHFTGVFYCGTPVLAKELKNLSHELTYKTSTRFEFHKEYF 215 K Y GVFYCG PVLAKELK LSHE+++KTSTRFEFHKEYF Sbjct: 877 KHPYSTIGVFYCGMPVLAKELKRLSHEMSHKTSTRFEFHKEYF 919 >ref|XP_010323982.1| PREDICTED: respiratory burst oxidase homolog protein E isoform X2 [Solanum lycopersicum] Length = 946 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/43 (79%), Positives = 34/43 (79%) Frame = +3 Query: 87 KRSYHFTGVFYCGTPVLAKELKNLSHELTYKTSTRFEFHKEYF 215 K Y GVFYCG P LAKELK LS ELTYKTSTRFEFHKEYF Sbjct: 904 KHPYSTVGVFYCGLPALAKELKKLSQELTYKTSTRFEFHKEYF 946 >ref|XP_010323981.1| PREDICTED: respiratory burst oxidase homolog protein E isoform X1 [Solanum lycopersicum] Length = 951 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/43 (79%), Positives = 34/43 (79%) Frame = +3 Query: 87 KRSYHFTGVFYCGTPVLAKELKNLSHELTYKTSTRFEFHKEYF 215 K Y GVFYCG P LAKELK LS ELTYKTSTRFEFHKEYF Sbjct: 909 KHPYSTVGVFYCGLPALAKELKKLSQELTYKTSTRFEFHKEYF 951 >ref|XP_009799187.1| PREDICTED: respiratory burst oxidase homolog protein E-like isoform X1 [Nicotiana sylvestris] gi|698507721|ref|XP_009799188.1| PREDICTED: respiratory burst oxidase homolog protein E-like isoform X1 [Nicotiana sylvestris] Length = 950 Score = 72.8 bits (177), Expect = 1e-10 Identities = 33/43 (76%), Positives = 34/43 (79%) Frame = +3 Query: 87 KRSYHFTGVFYCGTPVLAKELKNLSHELTYKTSTRFEFHKEYF 215 K Y GVFYCG P LAKEL+ LS ELTYKTSTRFEFHKEYF Sbjct: 908 KHPYSTVGVFYCGLPALAKELRKLSQELTYKTSTRFEFHKEYF 950 >ref|XP_009609858.1| PREDICTED: respiratory burst oxidase homolog protein E-like isoform X1 [Nicotiana tomentosiformis] Length = 948 Score = 72.8 bits (177), Expect = 1e-10 Identities = 33/43 (76%), Positives = 34/43 (79%) Frame = +3 Query: 87 KRSYHFTGVFYCGTPVLAKELKNLSHELTYKTSTRFEFHKEYF 215 K Y GVFYCG P LAKELK LS ELTYKTSTRF+FHKEYF Sbjct: 906 KHPYSTVGVFYCGLPALAKELKKLSQELTYKTSTRFDFHKEYF 948 >ref|XP_009359699.1| PREDICTED: respiratory burst oxidase homolog protein E-like [Pyrus x bretschneideri] Length = 917 Score = 72.8 bits (177), Expect = 1e-10 Identities = 33/43 (76%), Positives = 36/43 (83%) Frame = +3 Query: 87 KRSYHFTGVFYCGTPVLAKELKNLSHELTYKTSTRFEFHKEYF 215 K Y GVFYCG P+LAKELK LSHEL++KTSTRFEFHKEYF Sbjct: 875 KHPYSTVGVFYCGMPMLAKELKVLSHELSHKTSTRFEFHKEYF 917 >ref|XP_008242282.1| PREDICTED: respiratory burst oxidase homolog protein E [Prunus mume] Length = 912 Score = 72.8 bits (177), Expect = 1e-10 Identities = 33/43 (76%), Positives = 36/43 (83%) Frame = +3 Query: 87 KRSYHFTGVFYCGTPVLAKELKNLSHELTYKTSTRFEFHKEYF 215 K Y GVFYCG P+LAKELK LSHEL++KTSTRFEFHKEYF Sbjct: 870 KHPYSTVGVFYCGMPMLAKELKVLSHELSHKTSTRFEFHKEYF 912 >ref|XP_006353773.1| PREDICTED: respiratory burst oxidase homolog protein E-like isoform X2 [Solanum tuberosum] Length = 940 Score = 72.8 bits (177), Expect = 1e-10 Identities = 33/43 (76%), Positives = 34/43 (79%) Frame = +3 Query: 87 KRSYHFTGVFYCGTPVLAKELKNLSHELTYKTSTRFEFHKEYF 215 K Y GVFYCG P LAKELK LS ELTYKT+TRFEFHKEYF Sbjct: 898 KHPYSTVGVFYCGLPALAKELKKLSQELTYKTTTRFEFHKEYF 940 >ref|XP_006353772.1| PREDICTED: respiratory burst oxidase homolog protein E-like isoform X1 [Solanum tuberosum] Length = 964 Score = 72.8 bits (177), Expect = 1e-10 Identities = 33/43 (76%), Positives = 34/43 (79%) Frame = +3 Query: 87 KRSYHFTGVFYCGTPVLAKELKNLSHELTYKTSTRFEFHKEYF 215 K Y GVFYCG P LAKELK LS ELTYKT+TRFEFHKEYF Sbjct: 922 KHPYSTVGVFYCGLPALAKELKKLSQELTYKTTTRFEFHKEYF 964 >ref|XP_007203796.1| hypothetical protein PRUPE_ppa001114mg [Prunus persica] gi|462399327|gb|EMJ04995.1| hypothetical protein PRUPE_ppa001114mg [Prunus persica] Length = 906 Score = 72.8 bits (177), Expect = 1e-10 Identities = 33/43 (76%), Positives = 36/43 (83%) Frame = +3 Query: 87 KRSYHFTGVFYCGTPVLAKELKNLSHELTYKTSTRFEFHKEYF 215 K Y GVFYCG P+LAKELK LSHEL++KTSTRFEFHKEYF Sbjct: 864 KHPYSTVGVFYCGMPMLAKELKVLSHELSHKTSTRFEFHKEYF 906 >gb|KDO73805.1| hypothetical protein CISIN_1g0028301mg, partial [Citrus sinensis] Length = 641 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +3 Query: 108 GVFYCGTPVLAKELKNLSHELTYKTSTRFEFHKEYF 215 GVFYCG PVLAKELK LSHELT++TSTRFEFHKEYF Sbjct: 606 GVFYCGMPVLAKELKKLSHELTHRTSTRFEFHKEYF 641 >ref|XP_006474684.1| PREDICTED: respiratory burst oxidase homolog protein E-like [Citrus sinensis] Length = 892 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +3 Query: 108 GVFYCGTPVLAKELKNLSHELTYKTSTRFEFHKEYF 215 GVFYCG PVLAKELK LSHELT++TSTRFEFHKEYF Sbjct: 857 GVFYCGMPVLAKELKKLSHELTHRTSTRFEFHKEYF 892 >ref|XP_006452870.1| hypothetical protein CICLE_v10007394mg [Citrus clementina] gi|557556096|gb|ESR66110.1| hypothetical protein CICLE_v10007394mg [Citrus clementina] Length = 910 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +3 Query: 108 GVFYCGTPVLAKELKNLSHELTYKTSTRFEFHKEYF 215 GVFYCG PVLAKELK LSHELT++TSTRFEFHKEYF Sbjct: 875 GVFYCGMPVLAKELKKLSHELTHRTSTRFEFHKEYF 910 >ref|XP_011078139.1| PREDICTED: LOW QUALITY PROTEIN: respiratory burst oxidase homolog protein E [Sesamum indicum] Length = 907 Score = 72.0 bits (175), Expect = 2e-10 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = +3 Query: 108 GVFYCGTPVLAKELKNLSHELTYKTSTRFEFHKEYF 215 GVFYCG P+LAKELK LS ELTYKTSTRFEFHKEYF Sbjct: 872 GVFYCGLPILAKELKKLSQELTYKTSTRFEFHKEYF 907 >ref|XP_009769453.1| PREDICTED: respiratory burst oxidase homolog protein E-like [Nicotiana sylvestris] Length = 928 Score = 72.0 bits (175), Expect = 2e-10 Identities = 34/43 (79%), Positives = 34/43 (79%) Frame = +3 Query: 87 KRSYHFTGVFYCGTPVLAKELKNLSHELTYKTSTRFEFHKEYF 215 K Y GVFYCG PVLAKELK LS ELTYKTSTRFEFHKE F Sbjct: 886 KHPYSTVGVFYCGMPVLAKELKKLSQELTYKTSTRFEFHKENF 928 >ref|XP_009618954.1| PREDICTED: respiratory burst oxidase homolog protein E-like [Nicotiana tomentosiformis] Length = 931 Score = 72.0 bits (175), Expect = 2e-10 Identities = 34/43 (79%), Positives = 34/43 (79%) Frame = +3 Query: 87 KRSYHFTGVFYCGTPVLAKELKNLSHELTYKTSTRFEFHKEYF 215 K Y GVFYCG PVLAKELK LS ELTYKTSTRFEFHKE F Sbjct: 889 KHPYSTVGVFYCGMPVLAKELKKLSQELTYKTSTRFEFHKENF 931