BLASTX nr result
ID: Gardenia21_contig00044618
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00044618 (222 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP10733.1| unnamed protein product [Coffea canephora] 62 1e-07 >emb|CDP10733.1| unnamed protein product [Coffea canephora] Length = 729 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 91 APIYKEPPKIKRLEESVVNRIAAGEVIQRP 2 APIYKEPPKIKRLEESVVNRIAAGEVIQRP Sbjct: 9 APIYKEPPKIKRLEESVVNRIAAGEVIQRP 38