BLASTX nr result
ID: Gardenia21_contig00044570
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00044570 (310 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP11564.1| unnamed protein product [Coffea canephora] 74 6e-11 >emb|CDP11564.1| unnamed protein product [Coffea canephora] Length = 399 Score = 73.6 bits (179), Expect = 6e-11 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = -3 Query: 275 VSAVALDPSPRLKDIMEDKMQNEGPAMEILDKKCKGSESAS 153 VSAV LDPSPRLKD+M+DKMQNEGPAM ILD++CKGSE+AS Sbjct: 55 VSAVTLDPSPRLKDLMDDKMQNEGPAMVILDQECKGSETAS 95