BLASTX nr result
ID: Gardenia21_contig00043849
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00043849 (291 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO98337.1| unnamed protein product [Coffea canephora] 122 8e-26 ref|NP_001150484.1| 60S ribosomal protein L19-3 [Zea mays] gi|67... 81 3e-13 gb|AFW66503.1| hypothetical protein ZEAMMB73_479006 [Zea mays] 81 3e-13 gb|AFW66501.1| hypothetical protein ZEAMMB73_479006 [Zea mays] 81 3e-13 gb|AFW66500.1| hypothetical protein ZEAMMB73_479006 [Zea mays] 81 3e-13 gb|KNA12180.1| hypothetical protein SOVF_127810 [Spinacia oleracea] 81 3e-13 ref|XP_010674086.1| PREDICTED: 60S ribosomal protein L19-3-like ... 81 3e-13 ref|XP_009774381.1| PREDICTED: 60S ribosomal protein L19-1 isofo... 81 3e-13 ref|XP_009774380.1| PREDICTED: 60S ribosomal protein L19-3 isofo... 81 3e-13 ref|XP_009770183.1| PREDICTED: 60S ribosomal protein L19-3-like ... 81 3e-13 ref|XP_009592545.1| PREDICTED: 60S ribosomal protein L19-3-like ... 81 3e-13 ref|XP_009622699.1| PREDICTED: 60S ribosomal protein L19-3 [Nico... 81 3e-13 ref|XP_009622145.1| PREDICTED: 60S ribosomal protein L19-3-like ... 81 3e-13 ref|NP_001275013.1| 60S ribosomal protein L19-like protein [Sola... 81 3e-13 ref|XP_006359866.1| PREDICTED: 60S ribosomal protein L19-1-like ... 81 3e-13 ref|XP_006355818.1| PREDICTED: 60S ribosomal protein L19-1 [Sola... 81 3e-13 ref|XP_004247397.1| PREDICTED: 60S ribosomal protein L19-3 [Sola... 81 3e-13 ref|XP_004240553.1| PREDICTED: 60S ribosomal protein L19-3 [Sola... 81 3e-13 ref|XP_002983670.1| hypothetical protein SELMODRAFT_271656 [Sela... 81 3e-13 ref|XP_002982862.1| hypothetical protein SELMODRAFT_179747 [Sela... 81 3e-13 >emb|CDO98337.1| unnamed protein product [Coffea canephora] Length = 175 Score = 122 bits (307), Expect = 8e-26 Identities = 59/71 (83%), Positives = 64/71 (90%) Frame = +2 Query: 2 LLQRYQQCNRIDWHIYHDM*FKVKGNEFKNKHVLMENIHKFKVKKIRETSLYNQLTARRA 181 LLQRY++CNRID H+YHDM KVKGNEFKNK VLMENIHKFKVKKIRETSLYNQL AR+A Sbjct: 105 LLQRYRECNRIDRHMYHDMYLKVKGNEFKNKRVLMENIHKFKVKKIRETSLYNQLRARKA 164 Query: 182 QSKTAAMDQSQ 214 SK+AAMDQ Q Sbjct: 165 HSKSAAMDQKQ 175 >ref|NP_001150484.1| 60S ribosomal protein L19-3 [Zea mays] gi|670393822|ref|XP_008677322.1| PREDICTED: 60S ribosomal protein L19-3 isoform X1 [Zea mays] gi|195639566|gb|ACG39251.1| 60S ribosomal protein L19-3 [Zea mays] gi|238006088|gb|ACR34079.1| unknown [Zea mays] gi|413926565|gb|AFW66497.1| 60S ribosomal protein L19-3 isoform 1 [Zea mays] gi|413926566|gb|AFW66498.1| 60S ribosomal protein L19-3 isoform 2 [Zea mays] gi|413926567|gb|AFW66499.1| 60S ribosomal protein L19-3 isoform 3 [Zea mays] Length = 207 Score = 81.3 bits (199), Expect = 3e-13 Identities = 38/65 (58%), Positives = 50/65 (76%) Frame = +2 Query: 2 LLQRYQQCNRIDWHIYHDM*FKVKGNEFKNKHVLMENIHKFKVKKIRETSLYNQLTARRA 181 LL++Y++ +ID H+YHDM KVKGN FKNK VLME+IHK K +K RE +L +Q ARRA Sbjct: 105 LLRKYREAKKIDKHMYHDMYMKVKGNSFKNKRVLMESIHKSKAEKAREKTLSDQFEARRA 164 Query: 182 QSKTA 196 +SK + Sbjct: 165 KSKAS 169 >gb|AFW66503.1| hypothetical protein ZEAMMB73_479006 [Zea mays] Length = 112 Score = 81.3 bits (199), Expect = 3e-13 Identities = 38/65 (58%), Positives = 50/65 (76%) Frame = +2 Query: 2 LLQRYQQCNRIDWHIYHDM*FKVKGNEFKNKHVLMENIHKFKVKKIRETSLYNQLTARRA 181 LL++Y++ +ID H+YHDM KVKGN FKNK VLME+IHK K +K RE +L +Q ARRA Sbjct: 10 LLRKYREAKKIDKHMYHDMYMKVKGNSFKNKRVLMESIHKSKAEKAREKTLSDQFEARRA 69 Query: 182 QSKTA 196 +SK + Sbjct: 70 KSKAS 74 >gb|AFW66501.1| hypothetical protein ZEAMMB73_479006 [Zea mays] Length = 185 Score = 81.3 bits (199), Expect = 3e-13 Identities = 38/65 (58%), Positives = 50/65 (76%) Frame = +2 Query: 2 LLQRYQQCNRIDWHIYHDM*FKVKGNEFKNKHVLMENIHKFKVKKIRETSLYNQLTARRA 181 LL++Y++ +ID H+YHDM KVKGN FKNK VLME+IHK K +K RE +L +Q ARRA Sbjct: 105 LLRKYREAKKIDKHMYHDMYMKVKGNSFKNKRVLMESIHKSKAEKAREKTLSDQFEARRA 164 Query: 182 QSKTA 196 +SK + Sbjct: 165 KSKAS 169 >gb|AFW66500.1| hypothetical protein ZEAMMB73_479006 [Zea mays] Length = 989 Score = 81.3 bits (199), Expect = 3e-13 Identities = 38/65 (58%), Positives = 50/65 (76%) Frame = +2 Query: 2 LLQRYQQCNRIDWHIYHDM*FKVKGNEFKNKHVLMENIHKFKVKKIRETSLYNQLTARRA 181 LL++Y++ +ID H+YHDM KVKGN FKNK VLME+IHK K +K RE +L +Q ARRA Sbjct: 105 LLRKYREAKKIDKHMYHDMYMKVKGNSFKNKRVLMESIHKSKAEKAREKTLSDQFEARRA 164 Query: 182 QSKTA 196 +SK + Sbjct: 165 KSKAS 169 >gb|KNA12180.1| hypothetical protein SOVF_127810 [Spinacia oleracea] Length = 210 Score = 80.9 bits (198), Expect = 3e-13 Identities = 38/65 (58%), Positives = 50/65 (76%) Frame = +2 Query: 2 LLQRYQQCNRIDWHIYHDM*FKVKGNEFKNKHVLMENIHKFKVKKIRETSLYNQLTARRA 181 LL++Y++ +ID H+YHDM KVKGN FKNK VLMENIHK K +K RE +L +Q ARRA Sbjct: 105 LLRKYRESKKIDKHMYHDMYMKVKGNVFKNKRVLMENIHKSKAEKAREKTLSDQFEARRA 164 Query: 182 QSKTA 196 ++K + Sbjct: 165 KNKAS 169 >ref|XP_010674086.1| PREDICTED: 60S ribosomal protein L19-3-like [Beta vulgaris subsp. vulgaris] gi|870863082|gb|KMT14259.1| hypothetical protein BVRB_4g076150 [Beta vulgaris subsp. vulgaris] Length = 218 Score = 80.9 bits (198), Expect = 3e-13 Identities = 38/65 (58%), Positives = 50/65 (76%) Frame = +2 Query: 2 LLQRYQQCNRIDWHIYHDM*FKVKGNEFKNKHVLMENIHKFKVKKIRETSLYNQLTARRA 181 LL++Y++ +ID H+YHDM KVKGN FKNK VLMENIHK K +K RE +L +Q ARRA Sbjct: 105 LLRKYRESKKIDKHMYHDMYMKVKGNVFKNKRVLMENIHKSKAEKAREKTLSDQFEARRA 164 Query: 182 QSKTA 196 ++K + Sbjct: 165 KNKAS 169 >ref|XP_009774381.1| PREDICTED: 60S ribosomal protein L19-1 isoform X2 [Nicotiana sylvestris] Length = 206 Score = 80.9 bits (198), Expect = 3e-13 Identities = 38/65 (58%), Positives = 50/65 (76%) Frame = +2 Query: 2 LLQRYQQCNRIDWHIYHDM*FKVKGNEFKNKHVLMENIHKFKVKKIRETSLYNQLTARRA 181 LL++Y++ +ID H+YHDM KVKGN FKNK VLMENIHK K +K RE +L +Q ARRA Sbjct: 105 LLRKYRESKKIDRHMYHDMYMKVKGNVFKNKRVLMENIHKTKAEKAREKTLSDQFEARRA 164 Query: 182 QSKTA 196 ++K + Sbjct: 165 KNKAS 169 >ref|XP_009774380.1| PREDICTED: 60S ribosomal protein L19-3 isoform X1 [Nicotiana sylvestris] Length = 214 Score = 80.9 bits (198), Expect = 3e-13 Identities = 38/65 (58%), Positives = 50/65 (76%) Frame = +2 Query: 2 LLQRYQQCNRIDWHIYHDM*FKVKGNEFKNKHVLMENIHKFKVKKIRETSLYNQLTARRA 181 LL++Y++ +ID H+YHDM KVKGN FKNK VLMENIHK K +K RE +L +Q ARRA Sbjct: 105 LLRKYRESKKIDRHMYHDMYMKVKGNVFKNKRVLMENIHKTKAEKAREKTLSDQFEARRA 164 Query: 182 QSKTA 196 ++K + Sbjct: 165 KNKAS 169 >ref|XP_009770183.1| PREDICTED: 60S ribosomal protein L19-3-like [Nicotiana sylvestris] Length = 212 Score = 80.9 bits (198), Expect = 3e-13 Identities = 38/65 (58%), Positives = 50/65 (76%) Frame = +2 Query: 2 LLQRYQQCNRIDWHIYHDM*FKVKGNEFKNKHVLMENIHKFKVKKIRETSLYNQLTARRA 181 LL++Y++ +ID H+YHDM KVKGN FKNK VLMENIHK K +K RE +L +Q ARRA Sbjct: 105 LLRKYRESKKIDRHMYHDMYMKVKGNVFKNKRVLMENIHKTKAEKAREKTLSDQFEARRA 164 Query: 182 QSKTA 196 ++K + Sbjct: 165 KNKAS 169 >ref|XP_009592545.1| PREDICTED: 60S ribosomal protein L19-3-like [Nicotiana tomentosiformis] Length = 212 Score = 80.9 bits (198), Expect = 3e-13 Identities = 38/65 (58%), Positives = 50/65 (76%) Frame = +2 Query: 2 LLQRYQQCNRIDWHIYHDM*FKVKGNEFKNKHVLMENIHKFKVKKIRETSLYNQLTARRA 181 LL++Y++ +ID H+YHDM KVKGN FKNK VLMENIHK K +K RE +L +Q ARRA Sbjct: 105 LLRKYRESKKIDRHMYHDMYMKVKGNVFKNKRVLMENIHKTKAEKAREKTLSDQFEARRA 164 Query: 182 QSKTA 196 ++K + Sbjct: 165 KNKAS 169 >ref|XP_009622699.1| PREDICTED: 60S ribosomal protein L19-3 [Nicotiana tomentosiformis] gi|698424967|ref|XP_009784598.1| PREDICTED: 60S ribosomal protein L19-3 [Nicotiana sylvestris] Length = 212 Score = 80.9 bits (198), Expect = 3e-13 Identities = 38/65 (58%), Positives = 50/65 (76%) Frame = +2 Query: 2 LLQRYQQCNRIDWHIYHDM*FKVKGNEFKNKHVLMENIHKFKVKKIRETSLYNQLTARRA 181 LL++Y++ +ID H+YHDM KVKGN FKNK VLMENIHK K +K RE +L +Q ARRA Sbjct: 105 LLRKYRESKKIDRHMYHDMYMKVKGNVFKNKRVLMENIHKTKAEKAREKTLSDQFEARRA 164 Query: 182 QSKTA 196 ++K + Sbjct: 165 KNKAS 169 >ref|XP_009622145.1| PREDICTED: 60S ribosomal protein L19-3-like [Nicotiana tomentosiformis] Length = 211 Score = 80.9 bits (198), Expect = 3e-13 Identities = 38/65 (58%), Positives = 50/65 (76%) Frame = +2 Query: 2 LLQRYQQCNRIDWHIYHDM*FKVKGNEFKNKHVLMENIHKFKVKKIRETSLYNQLTARRA 181 LL++Y++ +ID H+YHDM KVKGN FKNK VLMENIHK K +K RE +L +Q ARRA Sbjct: 105 LLRKYRESKKIDRHMYHDMYMKVKGNVFKNKRVLMENIHKTKAEKAREKTLSDQFEARRA 164 Query: 182 QSKTA 196 ++K + Sbjct: 165 KNKAS 169 >ref|NP_001275013.1| 60S ribosomal protein L19-like protein [Solanum tuberosum] gi|83284003|gb|ABC01909.1| 60S ribosomal protein L19-like protein [Solanum tuberosum] Length = 209 Score = 80.9 bits (198), Expect = 3e-13 Identities = 38/65 (58%), Positives = 50/65 (76%) Frame = +2 Query: 2 LLQRYQQCNRIDWHIYHDM*FKVKGNEFKNKHVLMENIHKFKVKKIRETSLYNQLTARRA 181 LL++Y++ +ID H+YHDM KVKGN FKNK VLMENIHK K +K RE +L +Q ARRA Sbjct: 105 LLRKYRESKKIDKHMYHDMYMKVKGNVFKNKRVLMENIHKTKAEKAREKTLSDQFEARRA 164 Query: 182 QSKTA 196 ++K + Sbjct: 165 KNKAS 169 >ref|XP_006359866.1| PREDICTED: 60S ribosomal protein L19-1-like [Solanum tuberosum] Length = 220 Score = 80.9 bits (198), Expect = 3e-13 Identities = 38/65 (58%), Positives = 50/65 (76%) Frame = +2 Query: 2 LLQRYQQCNRIDWHIYHDM*FKVKGNEFKNKHVLMENIHKFKVKKIRETSLYNQLTARRA 181 LL++Y++ +ID H+YHDM KVKGN FKNK VLMENIHK K +K RE +L +Q ARRA Sbjct: 105 LLRKYRESKKIDKHMYHDMYMKVKGNVFKNKRVLMENIHKTKAEKAREKTLSDQFEARRA 164 Query: 182 QSKTA 196 ++K + Sbjct: 165 KNKAS 169 >ref|XP_006355818.1| PREDICTED: 60S ribosomal protein L19-1 [Solanum tuberosum] Length = 214 Score = 80.9 bits (198), Expect = 3e-13 Identities = 38/65 (58%), Positives = 50/65 (76%) Frame = +2 Query: 2 LLQRYQQCNRIDWHIYHDM*FKVKGNEFKNKHVLMENIHKFKVKKIRETSLYNQLTARRA 181 LL++Y++ +ID H+YHDM KVKGN FKNK VLMENIHK K +K RE +L +Q ARRA Sbjct: 105 LLRKYRESKKIDKHMYHDMYMKVKGNVFKNKRVLMENIHKTKAEKAREKTLSDQFEARRA 164 Query: 182 QSKTA 196 ++K + Sbjct: 165 KNKAS 169 >ref|XP_004247397.1| PREDICTED: 60S ribosomal protein L19-3 [Solanum lycopersicum] Length = 218 Score = 80.9 bits (198), Expect = 3e-13 Identities = 38/65 (58%), Positives = 50/65 (76%) Frame = +2 Query: 2 LLQRYQQCNRIDWHIYHDM*FKVKGNEFKNKHVLMENIHKFKVKKIRETSLYNQLTARRA 181 LL++Y++ +ID H+YHDM KVKGN FKNK VLMENIHK K +K RE +L +Q ARRA Sbjct: 105 LLRKYRESKKIDKHMYHDMYMKVKGNVFKNKRVLMENIHKTKAEKAREKTLSDQFEARRA 164 Query: 182 QSKTA 196 ++K + Sbjct: 165 KNKAS 169 >ref|XP_004240553.1| PREDICTED: 60S ribosomal protein L19-3 [Solanum lycopersicum] Length = 213 Score = 80.9 bits (198), Expect = 3e-13 Identities = 38/65 (58%), Positives = 50/65 (76%) Frame = +2 Query: 2 LLQRYQQCNRIDWHIYHDM*FKVKGNEFKNKHVLMENIHKFKVKKIRETSLYNQLTARRA 181 LL++Y++ +ID H+YHDM KVKGN FKNK VLMENIHK K +K RE +L +Q ARRA Sbjct: 105 LLRKYRESKKIDKHMYHDMYMKVKGNVFKNKRVLMENIHKTKAEKAREKTLSDQFEARRA 164 Query: 182 QSKTA 196 ++K + Sbjct: 165 KNKAS 169 >ref|XP_002983670.1| hypothetical protein SELMODRAFT_271656 [Selaginella moellendorffii] gi|302817730|ref|XP_002990540.1| hypothetical protein SELMODRAFT_185317 [Selaginella moellendorffii] gi|300141708|gb|EFJ08417.1| hypothetical protein SELMODRAFT_185317 [Selaginella moellendorffii] gi|300148507|gb|EFJ15166.1| hypothetical protein SELMODRAFT_271656 [Selaginella moellendorffii] Length = 184 Score = 80.9 bits (198), Expect = 3e-13 Identities = 38/63 (60%), Positives = 48/63 (76%) Frame = +2 Query: 2 LLQRYQQCNRIDWHIYHDM*FKVKGNEFKNKHVLMENIHKFKVKKIRETSLYNQLTARRA 181 LL++Y+ +ID H+YH M KVKGN FKNK VLMENIHKFK +K RE +L +Q ARRA Sbjct: 105 LLRKYRDAKKIDKHMYHSMYMKVKGNVFKNKRVLMENIHKFKAEKAREKTLTDQFEARRA 164 Query: 182 QSK 190 ++K Sbjct: 165 KNK 167 >ref|XP_002982862.1| hypothetical protein SELMODRAFT_179747 [Selaginella moellendorffii] gi|302818582|ref|XP_002990964.1| hypothetical protein SELMODRAFT_185685 [Selaginella moellendorffii] gi|300141295|gb|EFJ08008.1| hypothetical protein SELMODRAFT_185685 [Selaginella moellendorffii] gi|300149452|gb|EFJ16107.1| hypothetical protein SELMODRAFT_179747 [Selaginella moellendorffii] Length = 184 Score = 80.9 bits (198), Expect = 3e-13 Identities = 38/63 (60%), Positives = 48/63 (76%) Frame = +2 Query: 2 LLQRYQQCNRIDWHIYHDM*FKVKGNEFKNKHVLMENIHKFKVKKIRETSLYNQLTARRA 181 LL++Y+ +ID H+YH M KVKGN FKNK VLMENIHKFK +K RE +L +Q ARRA Sbjct: 105 LLRKYRDAKKIDKHMYHSMYMKVKGNVFKNKRVLMENIHKFKAEKAREKTLTDQFEARRA 164 Query: 182 QSK 190 ++K Sbjct: 165 KNK 167