BLASTX nr result
ID: Gardenia21_contig00043755
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00043755 (273 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME48896.1| hypothetical protein DOTSEDRAFT_67830 [Dothistrom... 86 8e-15 ref|XP_007920070.1| hypothetical protein MYCFIDRAFT_50227 [Pseud... 84 5e-14 gb|KJX92229.1| Gpr Fun34 family protein [Zymoseptoria brevis] 82 1e-13 ref|XP_003852057.1| hypothetical protein MYCGRDRAFT_104351 [Zymo... 79 1e-12 ref|XP_013346455.1| hypothetical protein AUEXF2481DRAFT_77853 [A... 79 1e-12 dbj|GAM89383.1| hypothetical protein ANO11243_074200 [fungal sp.... 78 3e-12 gb|KEQ63149.1| hypothetical protein M437DRAFT_47847 [Aureobasidi... 78 3e-12 ref|XP_007584325.1| putative gpr fun34 family protein [Neofusico... 77 5e-12 ref|XP_007678257.1| hypothetical protein BAUCODRAFT_544699 [Baud... 76 9e-12 gb|KEQ83896.1| hypothetical protein M438DRAFT_297712 [Aureobasid... 76 1e-11 gb|EKG17075.1| GPR1/FUN34/yaaH [Macrophomina phaseolina MS6] 74 3e-11 gb|KKY19111.1| putative gpr fun34 family protein [Diplodia seriata] 73 7e-11 gb|EMF16449.1| Grp1_Fun34_YaaH-domain-containing protein [Sphaer... 70 5e-10 ref|XP_013425497.1| hypothetical protein M436DRAFT_51301 [Aureob... 70 6e-10 gb|KFY20494.1| hypothetical protein V493_07670, partial [Pseudog... 65 2e-08 ref|XP_001547292.1| hypothetical protein BC1G_13914 [Botrytis ci... 65 2e-08 gb|ESZ89974.1| GPR/FUN34 family protein [Sclerotinia borealis F-... 64 3e-08 ref|XP_003305281.1| hypothetical protein PTT_18086 [Pyrenophora ... 64 3e-08 ref|XP_001937393.1| glyoxylate pathway regulator [Pyrenophora tr... 64 3e-08 ref|XP_014550888.1| hypothetical protein COCVIDRAFT_114260 [Bipo... 64 6e-08 >gb|EME48896.1| hypothetical protein DOTSEDRAFT_67830 [Dothistroma septosporum NZE10] Length = 291 Score = 86.3 bits (212), Expect = 8e-15 Identities = 44/67 (65%), Positives = 52/67 (77%), Gaps = 5/67 (7%) Frame = -1 Query: 189 SAQDFKD-ESDHINGTNGTSIHDHAK----QRKPYDYGGNPLAHINTGDSARLQAFGGAL 25 +AQD D + +H TNGT++HDHA QRKPYDYGGNPLAHINTG+SARL AFGG L Sbjct: 3 TAQDHNDMKPEH---TNGTAVHDHAAAAAAQRKPYDYGGNPLAHINTGESARLAAFGGEL 59 Query: 24 QSGLYKA 4 Q GLY++ Sbjct: 60 QPGLYRS 66 >ref|XP_007920070.1| hypothetical protein MYCFIDRAFT_50227 [Pseudocercospora fijiensis CIRAD86] gi|452989848|gb|EME89603.1| hypothetical protein MYCFIDRAFT_50227 [Pseudocercospora fijiensis CIRAD86] Length = 297 Score = 83.6 bits (205), Expect = 5e-14 Identities = 46/72 (63%), Positives = 47/72 (65%), Gaps = 9/72 (12%) Frame = -1 Query: 189 SAQDFKDESDHINGT-----NGTSIHDHA----KQRKPYDYGGNPLAHINTGDSARLQAF 37 SAQ DE NG NG HDHA QRKPYDYGGNPLAH+NTGDSARL AF Sbjct: 3 SAQGQNDEKP-TNGVQPGDFNGVGAHDHAGGVATQRKPYDYGGNPLAHVNTGDSARLAAF 61 Query: 36 GGALQSGLYKAD 1 GG LQ GLYK D Sbjct: 62 GGELQPGLYKVD 73 >gb|KJX92229.1| Gpr Fun34 family protein [Zymoseptoria brevis] Length = 293 Score = 82.4 bits (202), Expect = 1e-13 Identities = 38/53 (71%), Positives = 42/53 (79%) Frame = -1 Query: 162 DHINGTNGTSIHDHAKQRKPYDYGGNPLAHINTGDSARLQAFGGALQSGLYKA 4 DH+NGTNG SI RKPYDYGGNPLAH+NTGDS RL AFGG LQ GLY++ Sbjct: 21 DHVNGTNGASI------RKPYDYGGNPLAHVNTGDSVRLAAFGGELQPGLYRS 67 >ref|XP_003852057.1| hypothetical protein MYCGRDRAFT_104351 [Zymoseptoria tritici IPO323] gi|339471938|gb|EGP87033.1| hypothetical protein MYCGRDRAFT_104351 [Zymoseptoria tritici IPO323] Length = 293 Score = 79.3 bits (194), Expect = 1e-12 Identities = 37/53 (69%), Positives = 41/53 (77%) Frame = -1 Query: 162 DHINGTNGTSIHDHAKQRKPYDYGGNPLAHINTGDSARLQAFGGALQSGLYKA 4 DH NGTNG SI RKPYDYGGNPLAH+NTG+S RL AFGG LQ GLY++ Sbjct: 21 DHANGTNGASI------RKPYDYGGNPLAHVNTGESVRLAAFGGELQPGLYRS 67 >ref|XP_013346455.1| hypothetical protein AUEXF2481DRAFT_77853 [Aureobasidium subglaciale EXF-2481] gi|662540664|gb|KEQ97965.1| hypothetical protein AUEXF2481DRAFT_77853 [Aureobasidium subglaciale EXF-2481] Length = 293 Score = 79.0 bits (193), Expect = 1e-12 Identities = 38/56 (67%), Positives = 41/56 (73%), Gaps = 7/56 (12%) Frame = -1 Query: 153 NGTNGTSIHDHA-------KQRKPYDYGGNPLAHINTGDSARLQAFGGALQSGLYK 7 NG NG + +DHA KQRKPYDYGGNPLAHINTG+S RL AFGG Q GLYK Sbjct: 19 NGVNGVNGYDHATPNLGPIKQRKPYDYGGNPLAHINTGESVRLPAFGGEFQPGLYK 74 >dbj|GAM89383.1| hypothetical protein ANO11243_074200 [fungal sp. No.11243] Length = 288 Score = 77.8 bits (190), Expect = 3e-12 Identities = 37/70 (52%), Positives = 46/70 (65%) Frame = -1 Query: 213 TSIQTVIMSAQDFKDESDHINGTNGTSIHDHAKQRKPYDYGGNPLAHINTGDSARLQAFG 34 T++Q + + D + NG + T A+QRKPYDYGGNPLAH+NTGDSARL AFG Sbjct: 2 TTVQDQNVDGINGYDHAGATNGAHATGTTAPARQRKPYDYGGNPLAHVNTGDSARLPAFG 61 Query: 33 GALQSGLYKA 4 G Q G YK+ Sbjct: 62 GEFQPGAYKS 71 >gb|KEQ63149.1| hypothetical protein M437DRAFT_47847 [Aureobasidium melanogenum CBS 110374] Length = 279 Score = 77.8 bits (190), Expect = 3e-12 Identities = 38/60 (63%), Positives = 42/60 (70%), Gaps = 10/60 (16%) Frame = -1 Query: 156 INGTNGTSIHDHA----------KQRKPYDYGGNPLAHINTGDSARLQAFGGALQSGLYK 7 +NG NG + +DHA KQRKPYDYGGNPLAHINTG+S RL AFGG Q GLYK Sbjct: 1 MNGLNGVNGYDHATASMGAMPPVKQRKPYDYGGNPLAHINTGESVRLPAFGGEFQPGLYK 60 >ref|XP_007584325.1| putative gpr fun34 family protein [Neofusicoccum parvum UCRNP2] gi|485922864|gb|EOD48187.1| putative gpr fun34 family protein [Neofusicoccum parvum UCRNP2] Length = 295 Score = 77.0 bits (188), Expect = 5e-12 Identities = 42/68 (61%), Positives = 46/68 (67%), Gaps = 5/68 (7%) Frame = -1 Query: 192 MSAQDFKDESDHINGTNGTSIHDHA----KQRKPYDYGGNPLAHINTGD-SARLQAFGGA 28 MS+ + S INGTNGTS DHA KQR PYDYGGNPLAH+ T D S RL AFGG Sbjct: 1 MSSTTNPEVSKEINGTNGTSGADHAGVPPKQRSPYDYGGNPLAHVATNDPSLRLPAFGGE 60 Query: 27 LQSGLYKA 4 Q GLY+A Sbjct: 61 FQPGLYRA 68 >ref|XP_007678257.1| hypothetical protein BAUCODRAFT_544699 [Baudoinia panamericana UAMH 10762] gi|449298310|gb|EMC94325.1| hypothetical protein BAUCODRAFT_544699 [Baudoinia panamericana UAMH 10762] Length = 291 Score = 76.3 bits (186), Expect = 9e-12 Identities = 37/55 (67%), Positives = 42/55 (76%), Gaps = 1/55 (1%) Frame = -1 Query: 165 SDHINGTNGTSIHDHA-KQRKPYDYGGNPLAHINTGDSARLQAFGGALQSGLYKA 4 +D ++ NG+ DHA KQRKPYDYGGNPLAHINTGDS RL AFGG Q G YK+ Sbjct: 12 NDALHEKNGSHGIDHAAKQRKPYDYGGNPLAHINTGDSVRLPAFGGEFQPGTYKS 66 >gb|KEQ83896.1| hypothetical protein M438DRAFT_297712 [Aureobasidium pullulans EXF-150] Length = 294 Score = 75.9 bits (185), Expect = 1e-11 Identities = 37/55 (67%), Positives = 40/55 (72%), Gaps = 8/55 (14%) Frame = -1 Query: 147 TNGTSIHDHA--------KQRKPYDYGGNPLAHINTGDSARLQAFGGALQSGLYK 7 TNG + +DHA KQRKPYDYGGNPLAHINTG+S RL AFGG Q GLYK Sbjct: 21 TNGVNGYDHAPINNGVPLKQRKPYDYGGNPLAHINTGESVRLPAFGGEFQPGLYK 75 >gb|EKG17075.1| GPR1/FUN34/yaaH [Macrophomina phaseolina MS6] Length = 363 Score = 74.3 bits (181), Expect = 3e-11 Identities = 42/71 (59%), Positives = 46/71 (64%), Gaps = 5/71 (7%) Frame = -1 Query: 201 TVIMSAQDFKDESDHINGTNGTSIHDHA----KQRKPYDYGGNPLAHINTGD-SARLQAF 37 +V MS + S NGTNGTS DHA KQR PYDYGGNPLAH+ T D S RL AF Sbjct: 61 SVNMSTTINPEVSKETNGTNGTSGIDHAGIPPKQRSPYDYGGNPLAHVATNDPSLRLPAF 120 Query: 36 GGALQSGLYKA 4 GG Q GLY+A Sbjct: 121 GGEFQPGLYRA 131 >gb|KKY19111.1| putative gpr fun34 family protein [Diplodia seriata] Length = 293 Score = 73.2 bits (178), Expect = 7e-11 Identities = 38/60 (63%), Positives = 43/60 (71%), Gaps = 5/60 (8%) Frame = -1 Query: 168 ESDHINGTNGTSIHDHA----KQRKPYDYGGNPLAHINTGD-SARLQAFGGALQSGLYKA 4 +S +NGTNGTS DHA KQR PYDYGGNPLAH+ T D + RL AFGG Q GLY+A Sbjct: 10 DSKELNGTNGTSGIDHAAAPPKQRTPYDYGGNPLAHVVTNDPTMRLPAFGGEFQPGLYRA 69 >gb|EMF16449.1| Grp1_Fun34_YaaH-domain-containing protein [Sphaerulina musiva SO2202] Length = 300 Score = 70.5 bits (171), Expect = 5e-10 Identities = 36/56 (64%), Positives = 40/56 (71%), Gaps = 2/56 (3%) Frame = -1 Query: 162 DHINGTNGTSIHDHAKQRKPYDYGGNPL--AHINTGDSARLQAFGGALQSGLYKAD 1 DH NG +G AK RKPYDYGGNPL AH N+G+SARL +FGG LQ GLYK D Sbjct: 25 DHANGLDG------AKARKPYDYGGNPLYHAHTNSGESARLASFGGELQPGLYKVD 74 >ref|XP_013425497.1| hypothetical protein M436DRAFT_51301 [Aureobasidium namibiae CBS 147.97] gi|662513954|gb|KEQ71524.1| hypothetical protein M436DRAFT_51301 [Aureobasidium namibiae CBS 147.97] Length = 257 Score = 70.1 bits (170), Expect = 6e-10 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = -1 Query: 117 KQRKPYDYGGNPLAHINTGDSARLQAFGGALQSGLYK 7 KQRKPYDYGGNPLAHINTG+S RL AFGG Q GLYK Sbjct: 2 KQRKPYDYGGNPLAHINTGESVRLPAFGGEFQPGLYK 38 >gb|KFY20494.1| hypothetical protein V493_07670, partial [Pseudogymnoascus pannorum VKM F-4281 (FW-2241)] Length = 128 Score = 65.5 bits (158), Expect = 2e-08 Identities = 32/60 (53%), Positives = 39/60 (65%) Frame = -1 Query: 186 AQDFKDESDHINGTNGTSIHDHAKQRKPYDYGGNPLAHINTGDSARLQAFGGALQSGLYK 7 A D K + H N TN T+ + + + YDYGGNPL H +TG+SARL AFGG Q GLYK Sbjct: 11 AVDDKGAALHNNHTNNTNASNGINEVRAYDYGGNPLLHSHTGESARLPAFGGEFQPGLYK 70 >ref|XP_001547292.1| hypothetical protein BC1G_13914 [Botrytis cinerea B05.10] gi|347840494|emb|CCD55066.1| similar to GPR/FUN34 family protein [Botrytis cinerea T4] gi|472241400|gb|EMR86128.1| putative gpr fun34 family protein [Botrytis cinerea BcDW1] Length = 302 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/51 (60%), Positives = 37/51 (72%) Frame = -1 Query: 159 HINGTNGTSIHDHAKQRKPYDYGGNPLAHINTGDSARLQAFGGALQSGLYK 7 HING G + + +A + YDYGGNPLAH+NTG+SAR AFGG Q GLYK Sbjct: 30 HING-GGVNSNPNAHISRGYDYGGNPLAHMNTGESARFPAFGGEFQPGLYK 79 >gb|ESZ89974.1| GPR/FUN34 family protein [Sclerotinia borealis F-4157] Length = 302 Score = 64.3 bits (155), Expect = 3e-08 Identities = 35/68 (51%), Positives = 40/68 (58%), Gaps = 12/68 (17%) Frame = -1 Query: 174 KDESDHINGTNGTSIHDHAK------------QRKPYDYGGNPLAHINTGDSARLQAFGG 31 K+ S +GT GT HDHA + YDYGGNPLAH+NTG+SAR AFGG Sbjct: 13 KEYSSENSGT-GTHTHDHAPINGAGPNANNSAAARGYDYGGNPLAHMNTGESARFPAFGG 71 Query: 30 ALQSGLYK 7 Q GLYK Sbjct: 72 EFQPGLYK 79 >ref|XP_003305281.1| hypothetical protein PTT_18086 [Pyrenophora teres f. teres 0-1] gi|311317746|gb|EFQ86619.1| hypothetical protein PTT_18086 [Pyrenophora teres f. teres 0-1] Length = 298 Score = 64.3 bits (155), Expect = 3e-08 Identities = 33/54 (61%), Positives = 36/54 (66%), Gaps = 1/54 (1%) Frame = -1 Query: 165 SDHINGTNGTSIHDHAKQRKPYDYGGNPLAHINTGD-SARLQAFGGALQSGLYK 7 +DH GTNG + KQR PYDYGGNPLAHI T D RL AFGG Q GLY+ Sbjct: 23 TDHAAGTNGAGM---PKQRTPYDYGGNPLAHIATNDPDLRLAAFGGEFQPGLYR 73 >ref|XP_001937393.1| glyoxylate pathway regulator [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187984492|gb|EDU49980.1| glyoxylate pathway regulator [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 298 Score = 64.3 bits (155), Expect = 3e-08 Identities = 32/54 (59%), Positives = 36/54 (66%), Gaps = 1/54 (1%) Frame = -1 Query: 165 SDHINGTNGTSIHDHAKQRKPYDYGGNPLAHINTGD-SARLQAFGGALQSGLYK 7 +DH GTNG + KQR PYDYGGNPLAH+ T D RL AFGG Q GLY+ Sbjct: 23 TDHAAGTNGAGM---PKQRSPYDYGGNPLAHVATNDPELRLTAFGGEFQPGLYR 73 >ref|XP_014550888.1| hypothetical protein COCVIDRAFT_114260 [Bipolaris victoriae FI3] gi|578483760|gb|EUN21311.1| hypothetical protein COCVIDRAFT_114260 [Bipolaris victoriae FI3] Length = 296 Score = 63.5 bits (153), Expect = 6e-08 Identities = 33/51 (64%), Positives = 35/51 (68%), Gaps = 5/51 (9%) Frame = -1 Query: 144 NGTSIHDHA----KQRKPYDYGGNPLAHINTGD-SARLQAFGGALQSGLYK 7 NGTS DHA KQR PYDYGGNPLAH+ T D RL AFGG Q GLY+ Sbjct: 21 NGTSAVDHAGARPKQRTPYDYGGNPLAHVATNDPDLRLAAFGGEFQPGLYR 71