BLASTX nr result
ID: Gardenia21_contig00043745
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00043745 (378 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP02463.1| unnamed protein product [Coffea canephora] 57 4e-06 >emb|CDP02463.1| unnamed protein product [Coffea canephora] Length = 711 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +1 Query: 274 VKLSPCYFRSLTKSLAPRHSFSYLTRFRRPTVAS 375 +KLSP +FRSLTKSLAP HSFSYLTRF++PT +S Sbjct: 1 MKLSPRHFRSLTKSLAPNHSFSYLTRFQKPTASS 34