BLASTX nr result
ID: Gardenia21_contig00043686
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00043686 (287 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP03174.1| unnamed protein product [Coffea canephora] 86 1e-14 >emb|CDP03174.1| unnamed protein product [Coffea canephora] Length = 185 Score = 85.9 bits (211), Expect = 1e-14 Identities = 39/43 (90%), Positives = 41/43 (95%) Frame = -2 Query: 136 MTTMYGTIPTSDFHADRLSRVRSDLGKRRPWREMLSSFSFPDG 8 MTTMYGTIPTSDF+ADRL RVRSDLGKRRPW+EMLSS SFPDG Sbjct: 1 MTTMYGTIPTSDFYADRLDRVRSDLGKRRPWKEMLSSLSFPDG 43