BLASTX nr result
ID: Gardenia21_contig00043665
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00043665 (257 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP10131.1| unnamed protein product [Coffea canephora] 69 2e-12 >emb|CDP10131.1| unnamed protein product [Coffea canephora] Length = 436 Score = 69.3 bits (168), Expect(2) = 2e-12 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = +3 Query: 3 QGGASTSNEVASSSGCLKEIGLAVSHVFRSAPGCFTM 113 QGGASTSNEVASSS LKEIGLAVSHVFRSAPGCFTM Sbjct: 184 QGGASTSNEVASSSVRLKEIGLAVSHVFRSAPGCFTM 220 Score = 29.6 bits (65), Expect(2) = 2e-12 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = +1 Query: 205 FHRVKPMNTEIKQRKAV 255 F V PMNTEIKQRKAV Sbjct: 218 FTMVGPMNTEIKQRKAV 234