BLASTX nr result
ID: Gardenia21_contig00042489
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00042489 (258 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP13524.1| unnamed protein product [Coffea canephora] 57 5e-06 >emb|CDP13524.1| unnamed protein product [Coffea canephora] Length = 372 Score = 57.0 bits (136), Expect = 5e-06 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = -2 Query: 257 RRRDPFLFARKFSAECIGPLVEMANDVIFKD 165 RRRDPFLFARKFS C+GPL+++AND+IF+D Sbjct: 342 RRRDPFLFARKFSPTCVGPLMDIANDIIFRD 372