BLASTX nr result
ID: Gardenia21_contig00042212
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00042212 (300 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME49667.1| hypothetical protein DOTSEDRAFT_68446 [Dothistrom... 66 1e-08 gb|KJX94801.1| hypothetical protein TI39_contig4159g00021 [Zymos... 63 1e-07 ref|XP_007672038.1| hypothetical protein BAUCODRAFT_29233 [Baudo... 58 2e-06 ref|XP_001797092.1| hypothetical protein SNOG_06729 [Parastagono... 56 9e-06 >gb|EME49667.1| hypothetical protein DOTSEDRAFT_68446 [Dothistroma septosporum NZE10] Length = 906 Score = 65.9 bits (159), Expect = 1e-08 Identities = 34/51 (66%), Positives = 39/51 (76%), Gaps = 3/51 (5%) Frame = -2 Query: 146 PPMHDPSV-PSFYSTSMATG--ISCDIKPRLTKEQHDVLESHYQKQHKPTT 3 PP DPS P FY+ + G +SCDIKPRLTKEQHD+LESHYQKQ+KP T Sbjct: 27 PP--DPSTQPGFYNPNANLGQQMSCDIKPRLTKEQHDILESHYQKQNKPNT 75 >gb|KJX94801.1| hypothetical protein TI39_contig4159g00021 [Zymoseptoria brevis] Length = 875 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/40 (72%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Frame = -2 Query: 119 SFYS-TSMATGISCDIKPRLTKEQHDVLESHYQKQHKPTT 3 S+YS T++ I CDIKPRLTKEQHD+LESHYQKQ KP T Sbjct: 50 SYYSNTNLPASIPCDIKPRLTKEQHDILESHYQKQPKPNT 89 >ref|XP_007672038.1| hypothetical protein BAUCODRAFT_29233 [Baudoinia panamericana UAMH 10762] gi|449304847|gb|EMD00854.1| hypothetical protein BAUCODRAFT_29233 [Baudoinia panamericana UAMH 10762] Length = 849 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = -2 Query: 113 YSTSMATGISCDIKPRLTKEQHDVLESHYQKQHKPTT 3 Y M ++CDIKPRLTKEQHDVLE HYQ+Q KP+T Sbjct: 36 YHEGMQIPLTCDIKPRLTKEQHDVLEKHYQQQSKPST 72 >ref|XP_001797092.1| hypothetical protein SNOG_06729 [Parastagonospora nodorum SN15] gi|160701392|gb|EAT85380.2| hypothetical protein SNOG_06729 [Parastagonospora nodorum SN15] Length = 768 Score = 56.2 bits (134), Expect = 9e-06 Identities = 22/27 (81%), Positives = 26/27 (96%) Frame = -2 Query: 83 CDIKPRLTKEQHDVLESHYQKQHKPTT 3 CD+KPRLTKEQHDVLE H+Q+QHKP+T Sbjct: 26 CDVKPRLTKEQHDVLEQHFQQQHKPST 52