BLASTX nr result
ID: Gardenia21_contig00042030
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00042030 (257 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP01647.1| unnamed protein product [Coffea canephora] 79 2e-12 >emb|CDP01647.1| unnamed protein product [Coffea canephora] Length = 188 Score = 78.6 bits (192), Expect = 2e-12 Identities = 35/47 (74%), Positives = 39/47 (82%) Frame = -2 Query: 256 EGTGKRKTKTSRGFWMKYEAVCGSRKDDVVDGRSFRIASIHGGRKSW 116 E K+K K SRGFW+KY AVCGSRKDDVVDGRSF+IA HGGRK+W Sbjct: 142 ERKSKQKPKNSRGFWIKYGAVCGSRKDDVVDGRSFKIAYSHGGRKNW 188