BLASTX nr result
ID: Gardenia21_contig00042023
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00042023 (352 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP11524.1| unnamed protein product [Coffea canephora] 98 3e-18 >emb|CDP11524.1| unnamed protein product [Coffea canephora] Length = 339 Score = 97.8 bits (242), Expect = 3e-18 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 1/57 (1%) Frame = -3 Query: 170 MVISASSSRWDRRRPQLL-GVRRTHRRWPSFLPFPSAPRRSIVFRWLLVALAFIAIL 3 M ISASSSRW+R+RPQLL GVRRTHRRWP FLPFPS RR+IVFRWLL+ALAFIAIL Sbjct: 1 MAISASSSRWNRQRPQLLLGVRRTHRRWPPFLPFPSTIRRNIVFRWLLIALAFIAIL 57