BLASTX nr result
ID: Gardenia21_contig00041393
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00041393 (408 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009366440.1| PREDICTED: pentatricopeptide repeat-containi... 138 2e-30 ref|XP_009366439.1| PREDICTED: pentatricopeptide repeat-containi... 138 2e-30 ref|XP_008240495.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 137 2e-30 ref|XP_008386813.1| PREDICTED: pentatricopeptide repeat-containi... 137 3e-30 ref|XP_011089782.1| PREDICTED: pentatricopeptide repeat-containi... 136 5e-30 ref|XP_011089777.1| PREDICTED: pentatricopeptide repeat-containi... 136 5e-30 gb|KOM55526.1| hypothetical protein LR48_Vigan10g141800 [Vigna a... 135 1e-29 ref|XP_011459312.1| PREDICTED: pentatricopeptide repeat-containi... 135 2e-29 emb|CBI29931.3| unnamed protein product [Vitis vinifera] 135 2e-29 ref|XP_007151839.1| hypothetical protein PHAVU_004G079600g [Phas... 134 2e-29 ref|XP_014492489.1| PREDICTED: pentatricopeptide repeat-containi... 134 3e-29 ref|XP_012067069.1| PREDICTED: pentatricopeptide repeat-containi... 133 6e-29 gb|KHN00671.1| Pentatricopeptide repeat-containing protein [Glyc... 133 6e-29 gb|KDP42077.1| hypothetical protein JCGZ_01865 [Jatropha curcas] 133 6e-29 ref|XP_006574752.1| PREDICTED: pentatricopeptide repeat-containi... 133 6e-29 ref|XP_004233816.1| PREDICTED: pentatricopeptide repeat-containi... 132 1e-28 ref|XP_004142047.2| PREDICTED: pentatricopeptide repeat-containi... 131 2e-28 gb|KGN48404.1| hypothetical protein Csa_6G486770 [Cucumis sativus] 131 2e-28 gb|KDO55063.1| hypothetical protein CISIN_1g040643mg [Citrus sin... 131 2e-28 ref|XP_006479094.1| PREDICTED: pentatricopeptide repeat-containi... 131 2e-28 >ref|XP_009366440.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 isoform X2 [Pyrus x bretschneideri] Length = 1086 Score = 138 bits (347), Expect = 2e-30 Identities = 59/73 (80%), Positives = 68/73 (93%) Frame = -1 Query: 408 TALIHSEKLAIAFGLLSLSDSIPLRVMKNLRVCNDCHNWIKYVSKVENRTIVVRDTYRFH 229 T IHSEKLAI+FGLL+LS++IP+RVMKNLRVCNDCHNWIKY SK+ NRTI+VRD YRFH Sbjct: 1014 TVYIHSEKLAISFGLLNLSNAIPVRVMKNLRVCNDCHNWIKYTSKICNRTIIVRDAYRFH 1073 Query: 228 HFKDGLCSCKDYW 190 HFKDG+CSC+DYW Sbjct: 1074 HFKDGVCSCRDYW 1086 >ref|XP_009366439.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 isoform X1 [Pyrus x bretschneideri] Length = 1087 Score = 138 bits (347), Expect = 2e-30 Identities = 59/73 (80%), Positives = 68/73 (93%) Frame = -1 Query: 408 TALIHSEKLAIAFGLLSLSDSIPLRVMKNLRVCNDCHNWIKYVSKVENRTIVVRDTYRFH 229 T IHSEKLAI+FGLL+LS++IP+RVMKNLRVCNDCHNWIKY SK+ NRTI+VRD YRFH Sbjct: 1015 TVYIHSEKLAISFGLLNLSNAIPVRVMKNLRVCNDCHNWIKYTSKICNRTIIVRDAYRFH 1074 Query: 228 HFKDGLCSCKDYW 190 HFKDG+CSC+DYW Sbjct: 1075 HFKDGVCSCRDYW 1087 >ref|XP_008240495.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g13650 [Prunus mume] Length = 988 Score = 137 bits (346), Expect = 2e-30 Identities = 58/73 (79%), Positives = 69/73 (94%) Frame = -1 Query: 408 TALIHSEKLAIAFGLLSLSDSIPLRVMKNLRVCNDCHNWIKYVSKVENRTIVVRDTYRFH 229 T IHSEKLAI+FGLLSLS++IP+RV+KNLRVCNDCHNWIKY+SK+ +RTI+VRD YRFH Sbjct: 916 TEYIHSEKLAISFGLLSLSNTIPIRVIKNLRVCNDCHNWIKYMSKISDRTIIVRDAYRFH 975 Query: 228 HFKDGLCSCKDYW 190 HFKDG+CSC+DYW Sbjct: 976 HFKDGVCSCRDYW 988 >ref|XP_008386813.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 [Malus domestica] gi|657989243|ref|XP_008386814.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 [Malus domestica] Length = 1084 Score = 137 bits (345), Expect = 3e-30 Identities = 58/73 (79%), Positives = 67/73 (91%) Frame = -1 Query: 408 TALIHSEKLAIAFGLLSLSDSIPLRVMKNLRVCNDCHNWIKYVSKVENRTIVVRDTYRFH 229 T IHSEKLAI+FGLL+LS+++P+RVMKNLRVCNDCHNWIKY SK+ NRTI+VRD YRFH Sbjct: 1012 TVYIHSEKLAISFGLLNLSNAVPIRVMKNLRVCNDCHNWIKYTSKICNRTIIVRDAYRFH 1071 Query: 228 HFKDGLCSCKDYW 190 HFKDG CSC+DYW Sbjct: 1072 HFKDGACSCRDYW 1084 >ref|XP_011089782.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 isoform X2 [Sesamum indicum] Length = 1023 Score = 136 bits (343), Expect = 5e-30 Identities = 60/73 (82%), Positives = 67/73 (91%) Frame = -1 Query: 408 TALIHSEKLAIAFGLLSLSDSIPLRVMKNLRVCNDCHNWIKYVSKVENRTIVVRDTYRFH 229 TA IHSEKLA+ FGLLSLS+ IPL VMKNLRVCNDCHNWIK+VSKV +RTI+VRD YRFH Sbjct: 951 TAYIHSEKLAVVFGLLSLSNMIPLHVMKNLRVCNDCHNWIKFVSKVVDRTIIVRDAYRFH 1010 Query: 228 HFKDGLCSCKDYW 190 HF++GLCSCKDYW Sbjct: 1011 HFQNGLCSCKDYW 1023 >ref|XP_011089777.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 isoform X1 [Sesamum indicum] gi|747084712|ref|XP_011089778.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 isoform X1 [Sesamum indicum] gi|747084714|ref|XP_011089779.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 isoform X1 [Sesamum indicum] gi|747084716|ref|XP_011089780.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 isoform X1 [Sesamum indicum] Length = 1054 Score = 136 bits (343), Expect = 5e-30 Identities = 60/73 (82%), Positives = 67/73 (91%) Frame = -1 Query: 408 TALIHSEKLAIAFGLLSLSDSIPLRVMKNLRVCNDCHNWIKYVSKVENRTIVVRDTYRFH 229 TA IHSEKLA+ FGLLSLS+ IPL VMKNLRVCNDCHNWIK+VSKV +RTI+VRD YRFH Sbjct: 982 TAYIHSEKLAVVFGLLSLSNMIPLHVMKNLRVCNDCHNWIKFVSKVVDRTIIVRDAYRFH 1041 Query: 228 HFKDGLCSCKDYW 190 HF++GLCSCKDYW Sbjct: 1042 HFQNGLCSCKDYW 1054 >gb|KOM55526.1| hypothetical protein LR48_Vigan10g141800 [Vigna angularis] Length = 1091 Score = 135 bits (340), Expect = 1e-29 Identities = 59/73 (80%), Positives = 65/73 (89%) Frame = -1 Query: 408 TALIHSEKLAIAFGLLSLSDSIPLRVMKNLRVCNDCHNWIKYVSKVENRTIVVRDTYRFH 229 T +IHSEKLAIAFGLLSLS S P+ V KNLRVC DCHNWIKYVSK+ +R IVVRD+YRFH Sbjct: 1019 TQIIHSEKLAIAFGLLSLSSSSPIHVFKNLRVCGDCHNWIKYVSKISDRVIVVRDSYRFH 1078 Query: 228 HFKDGLCSCKDYW 190 HFKDG+CSCKDYW Sbjct: 1079 HFKDGICSCKDYW 1091 >ref|XP_011459312.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 [Fragaria vesca subsp. vesca] gi|764543434|ref|XP_011459313.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 [Fragaria vesca subsp. vesca] gi|764543439|ref|XP_011459314.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 [Fragaria vesca subsp. vesca] gi|764543443|ref|XP_011459315.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 [Fragaria vesca subsp. vesca] gi|764543448|ref|XP_011459316.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 [Fragaria vesca subsp. vesca] Length = 1074 Score = 135 bits (339), Expect = 2e-29 Identities = 57/73 (78%), Positives = 65/73 (89%) Frame = -1 Query: 408 TALIHSEKLAIAFGLLSLSDSIPLRVMKNLRVCNDCHNWIKYVSKVENRTIVVRDTYRFH 229 T IHSEKLAI FGL+SLS +IP+RV+KNLRVCNDCHNWIK+ SK+ RTI+VRD YRFH Sbjct: 1002 TVYIHSEKLAITFGLISLSSTIPIRVIKNLRVCNDCHNWIKHTSKISKRTIIVRDAYRFH 1061 Query: 228 HFKDGLCSCKDYW 190 HFKDG+CSCKDYW Sbjct: 1062 HFKDGVCSCKDYW 1074 >emb|CBI29931.3| unnamed protein product [Vitis vinifera] Length = 838 Score = 135 bits (339), Expect = 2e-29 Identities = 57/73 (78%), Positives = 68/73 (93%) Frame = -1 Query: 408 TALIHSEKLAIAFGLLSLSDSIPLRVMKNLRVCNDCHNWIKYVSKVENRTIVVRDTYRFH 229 TA IHSEKLA+AFGLLSL++++P+RV+KNLRVCNDCHNWIK+VSK+ NR IVVRD YRFH Sbjct: 766 TAYIHSEKLAVAFGLLSLTNTMPIRVIKNLRVCNDCHNWIKFVSKISNRAIVVRDAYRFH 825 Query: 228 HFKDGLCSCKDYW 190 HF+ G+CSCKDYW Sbjct: 826 HFEGGVCSCKDYW 838 >ref|XP_007151839.1| hypothetical protein PHAVU_004G079600g [Phaseolus vulgaris] gi|561025148|gb|ESW23833.1| hypothetical protein PHAVU_004G079600g [Phaseolus vulgaris] Length = 1052 Score = 134 bits (338), Expect = 2e-29 Identities = 58/73 (79%), Positives = 65/73 (89%) Frame = -1 Query: 408 TALIHSEKLAIAFGLLSLSDSIPLRVMKNLRVCNDCHNWIKYVSKVENRTIVVRDTYRFH 229 T +IHSEKLAIAFGLLSLS S P+ V KNLRVC DCHNWIKYVSK+ +R I+VRD+YRFH Sbjct: 980 TQVIHSEKLAIAFGLLSLSSSSPIHVFKNLRVCGDCHNWIKYVSKISDRVIIVRDSYRFH 1039 Query: 228 HFKDGLCSCKDYW 190 HFKDG+CSCKDYW Sbjct: 1040 HFKDGICSCKDYW 1052 >ref|XP_014492489.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 [Vigna radiata var. radiata] Length = 1064 Score = 134 bits (337), Expect = 3e-29 Identities = 58/73 (79%), Positives = 65/73 (89%) Frame = -1 Query: 408 TALIHSEKLAIAFGLLSLSDSIPLRVMKNLRVCNDCHNWIKYVSKVENRTIVVRDTYRFH 229 T +IHSEKLAI+FGLLSLS S P+ V KNLRVC DCHNWIKYVSK+ +R IVVRD+YRFH Sbjct: 992 TQIIHSEKLAISFGLLSLSSSSPIHVFKNLRVCGDCHNWIKYVSKISDRVIVVRDSYRFH 1051 Query: 228 HFKDGLCSCKDYW 190 HFKDG+CSCKDYW Sbjct: 1052 HFKDGICSCKDYW 1064 >ref|XP_012067069.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 [Jatropha curcas] Length = 1062 Score = 133 bits (334), Expect = 6e-29 Identities = 57/73 (78%), Positives = 64/73 (87%) Frame = -1 Query: 408 TALIHSEKLAIAFGLLSLSDSIPLRVMKNLRVCNDCHNWIKYVSKVENRTIVVRDTYRFH 229 TA +HSEKLA AFGLLSLSD IP+RVMKNLRVC DCH W+K+VSK+ NRTIVVRD YRFH Sbjct: 990 TAFVHSEKLATAFGLLSLSDPIPIRVMKNLRVCTDCHTWLKFVSKISNRTIVVRDAYRFH 1049 Query: 228 HFKDGLCSCKDYW 190 HF+ G CSC+DYW Sbjct: 1050 HFEGGACSCRDYW 1062 >gb|KHN00671.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 1082 Score = 133 bits (334), Expect = 6e-29 Identities = 58/73 (79%), Positives = 64/73 (87%) Frame = -1 Query: 408 TALIHSEKLAIAFGLLSLSDSIPLRVMKNLRVCNDCHNWIKYVSKVENRTIVVRDTYRFH 229 T +IHSEKLAIAFGLLSLS S P+ V KNLRVC DCHNWIKYVSK+ +R IVVRD+YRFH Sbjct: 1010 TQIIHSEKLAIAFGLLSLSSSTPIHVFKNLRVCGDCHNWIKYVSKISDRVIVVRDSYRFH 1069 Query: 228 HFKDGLCSCKDYW 190 HFK G+CSCKDYW Sbjct: 1070 HFKGGICSCKDYW 1082 >gb|KDP42077.1| hypothetical protein JCGZ_01865 [Jatropha curcas] Length = 161 Score = 133 bits (334), Expect = 6e-29 Identities = 57/73 (78%), Positives = 64/73 (87%) Frame = -1 Query: 408 TALIHSEKLAIAFGLLSLSDSIPLRVMKNLRVCNDCHNWIKYVSKVENRTIVVRDTYRFH 229 TA +HSEKLA AFGLLSLSD IP+RVMKNLRVC DCH W+K+VSK+ NRTIVVRD YRFH Sbjct: 89 TAFVHSEKLATAFGLLSLSDPIPIRVMKNLRVCTDCHTWLKFVSKISNRTIVVRDAYRFH 148 Query: 228 HFKDGLCSCKDYW 190 HF+ G CSC+DYW Sbjct: 149 HFEGGACSCRDYW 161 >ref|XP_006574752.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like isoform X1 [Glycine max] gi|571439084|ref|XP_006574753.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like isoform X2 [Glycine max] gi|571439086|ref|XP_006574754.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like isoform X3 [Glycine max] gi|571439088|ref|XP_006574755.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like isoform X4 [Glycine max] gi|571439090|ref|XP_006574756.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like isoform X5 [Glycine max] gi|947121940|gb|KRH70146.1| hypothetical protein GLYMA_02G071600 [Glycine max] gi|947121941|gb|KRH70147.1| hypothetical protein GLYMA_02G071600 [Glycine max] gi|947121942|gb|KRH70148.1| hypothetical protein GLYMA_02G071600 [Glycine max] gi|947121943|gb|KRH70149.1| hypothetical protein GLYMA_02G071600 [Glycine max] Length = 1082 Score = 133 bits (334), Expect = 6e-29 Identities = 58/73 (79%), Positives = 64/73 (87%) Frame = -1 Query: 408 TALIHSEKLAIAFGLLSLSDSIPLRVMKNLRVCNDCHNWIKYVSKVENRTIVVRDTYRFH 229 T +IHSEKLAIAFGLLSLS S P+ V KNLRVC DCHNWIKYVSK+ +R IVVRD+YRFH Sbjct: 1010 TQIIHSEKLAIAFGLLSLSSSTPIHVFKNLRVCGDCHNWIKYVSKISDRVIVVRDSYRFH 1069 Query: 228 HFKDGLCSCKDYW 190 HFK G+CSCKDYW Sbjct: 1070 HFKGGICSCKDYW 1082 >ref|XP_004233816.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 [Solanum lycopersicum] gi|723674247|ref|XP_010316659.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 [Solanum lycopersicum] gi|723674250|ref|XP_010316660.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 [Solanum lycopersicum] gi|723674253|ref|XP_010316661.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 [Solanum lycopersicum] gi|723674256|ref|XP_010316662.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 [Solanum lycopersicum] gi|723674259|ref|XP_010316663.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 [Solanum lycopersicum] gi|723674262|ref|XP_010316664.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 [Solanum lycopersicum] gi|723674265|ref|XP_010316665.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 [Solanum lycopersicum] gi|723674268|ref|XP_010316666.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 [Solanum lycopersicum] gi|723674271|ref|XP_010316667.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 [Solanum lycopersicum] gi|723674276|ref|XP_010316668.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 [Solanum lycopersicum] Length = 1057 Score = 132 bits (331), Expect = 1e-28 Identities = 59/73 (80%), Positives = 63/73 (86%) Frame = -1 Query: 408 TALIHSEKLAIAFGLLSLSDSIPLRVMKNLRVCNDCHNWIKYVSKVENRTIVVRDTYRFH 229 TA IHSEKLAIAFGLLSL + IP+RVMKNLRVCNDCHNWIK VSKV NR I+VRD YRFH Sbjct: 985 TAYIHSEKLAIAFGLLSLHEMIPIRVMKNLRVCNDCHNWIKCVSKVANRAIIVRDAYRFH 1044 Query: 228 HFKDGLCSCKDYW 190 HF DG CSC D+W Sbjct: 1045 HFADGQCSCNDFW 1057 >ref|XP_004142047.2| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 [Cucumis sativus] Length = 1056 Score = 131 bits (330), Expect = 2e-28 Identities = 55/70 (78%), Positives = 65/70 (92%) Frame = -1 Query: 399 IHSEKLAIAFGLLSLSDSIPLRVMKNLRVCNDCHNWIKYVSKVENRTIVVRDTYRFHHFK 220 +HSEKLAIAFGLLSL ++IP+RVMKNLRVCNDCHNWIKYVSK+ NR+I+VRD +RFHHF Sbjct: 987 VHSEKLAIAFGLLSLGNNIPIRVMKNLRVCNDCHNWIKYVSKISNRSIIVRDAHRFHHFD 1046 Query: 219 DGLCSCKDYW 190 G+CSCKD+W Sbjct: 1047 GGVCSCKDFW 1056 >gb|KGN48404.1| hypothetical protein Csa_6G486770 [Cucumis sativus] Length = 1036 Score = 131 bits (330), Expect = 2e-28 Identities = 55/70 (78%), Positives = 65/70 (92%) Frame = -1 Query: 399 IHSEKLAIAFGLLSLSDSIPLRVMKNLRVCNDCHNWIKYVSKVENRTIVVRDTYRFHHFK 220 +HSEKLAIAFGLLSL ++IP+RVMKNLRVCNDCHNWIKYVSK+ NR+I+VRD +RFHHF Sbjct: 967 VHSEKLAIAFGLLSLGNNIPIRVMKNLRVCNDCHNWIKYVSKISNRSIIVRDAHRFHHFD 1026 Query: 219 DGLCSCKDYW 190 G+CSCKD+W Sbjct: 1027 GGVCSCKDFW 1036 >gb|KDO55063.1| hypothetical protein CISIN_1g040643mg [Citrus sinensis] Length = 968 Score = 131 bits (329), Expect = 2e-28 Identities = 57/70 (81%), Positives = 65/70 (92%) Frame = -1 Query: 399 IHSEKLAIAFGLLSLSDSIPLRVMKNLRVCNDCHNWIKYVSKVENRTIVVRDTYRFHHFK 220 IHSEKLAIAFGLLSLSDS+P+ V+KNLRVCNDCHNWIK+VSK+ NRTIVVRD RFHHF+ Sbjct: 899 IHSEKLAIAFGLLSLSDSMPILVIKNLRVCNDCHNWIKFVSKISNRTIVVRDANRFHHFE 958 Query: 219 DGLCSCKDYW 190 G+CSC+DYW Sbjct: 959 GGVCSCRDYW 968 >ref|XP_006479094.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like isoform X1 [Citrus sinensis] gi|568850820|ref|XP_006479095.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like isoform X2 [Citrus sinensis] gi|568850822|ref|XP_006479096.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like isoform X3 [Citrus sinensis] Length = 1077 Score = 131 bits (329), Expect = 2e-28 Identities = 57/70 (81%), Positives = 65/70 (92%) Frame = -1 Query: 399 IHSEKLAIAFGLLSLSDSIPLRVMKNLRVCNDCHNWIKYVSKVENRTIVVRDTYRFHHFK 220 IHSEKLAIAFGLLSLSDS+P+ V+KNLRVCNDCHNWIK+VSK+ NRTIVVRD RFHHF+ Sbjct: 1008 IHSEKLAIAFGLLSLSDSMPILVIKNLRVCNDCHNWIKFVSKISNRTIVVRDANRFHHFE 1067 Query: 219 DGLCSCKDYW 190 G+CSC+DYW Sbjct: 1068 GGVCSCRDYW 1077