BLASTX nr result
ID: Gardenia21_contig00041340
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00041340 (250 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO98336.1| unnamed protein product [Coffea canephora] 70 5e-10 >emb|CDO98336.1| unnamed protein product [Coffea canephora] Length = 571 Score = 70.5 bits (171), Expect = 5e-10 Identities = 33/39 (84%), Positives = 34/39 (87%) Frame = +1 Query: 133 MQRASSEKLLALCRKWPLPLLSFHEPSKSCLFSTYSHPG 249 MQRASS+K LALCRKWPLPL SFHEPSKS FSTYSH G Sbjct: 1 MQRASSKKFLALCRKWPLPLFSFHEPSKSRHFSTYSHLG 39