BLASTX nr result
ID: Gardenia21_contig00041239
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00041239 (451 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP12131.1| unnamed protein product [Coffea canephora] 72 2e-10 ref|XP_012854315.1| PREDICTED: protein trichome birefringence-li... 58 2e-06 ref|XP_012854316.1| PREDICTED: protein trichome birefringence-li... 58 2e-06 >emb|CDP12131.1| unnamed protein product [Coffea canephora] Length = 459 Score = 71.6 bits (174), Expect = 2e-10 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 99 MMKRISFNWKSWWWSLHKQNYLVLKLGVSILLI 1 MMK+ISFNW SWWWSLHKQNYLVLKLGVSILLI Sbjct: 1 MMKKISFNWTSWWWSLHKQNYLVLKLGVSILLI 33 >ref|XP_012854315.1| PREDICTED: protein trichome birefringence-like 24 isoform X1 [Erythranthe guttatus] Length = 446 Score = 58.2 bits (139), Expect = 2e-06 Identities = 22/33 (66%), Positives = 30/33 (90%) Frame = -2 Query: 99 MMKRISFNWKSWWWSLHKQNYLVLKLGVSILLI 1 M+K++++NWKSWW LHK NYLV+KLGVS+LL+ Sbjct: 1 MVKKMAYNWKSWWRPLHKNNYLVIKLGVSVLLV 33 >ref|XP_012854316.1| PREDICTED: protein trichome birefringence-like 24 isoform X2 [Erythranthe guttatus] gi|604304032|gb|EYU23382.1| hypothetical protein MIMGU_mgv1a006445mg [Erythranthe guttata] Length = 444 Score = 58.2 bits (139), Expect = 2e-06 Identities = 22/33 (66%), Positives = 30/33 (90%) Frame = -2 Query: 99 MMKRISFNWKSWWWSLHKQNYLVLKLGVSILLI 1 M+K++++NWKSWW LHK NYLV+KLGVS+LL+ Sbjct: 1 MVKKMAYNWKSWWRPLHKNNYLVIKLGVSVLLV 33