BLASTX nr result
ID: Gardenia21_contig00041061
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00041061 (344 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP00196.1| unnamed protein product [Coffea canephora] 83 7e-14 >emb|CDP00196.1| unnamed protein product [Coffea canephora] Length = 368 Score = 83.2 bits (204), Expect = 7e-14 Identities = 42/54 (77%), Positives = 44/54 (81%) Frame = -2 Query: 337 SIIGALTCGLGYYTLIWGQIISYDEVVKNNNHKSCSSPSDHHKTPLLQQEDSQV 176 SIIGAL CGLG+YTLIWGQI+ YDE NHKS SSPSD KTPLLQQEDSQV Sbjct: 316 SIIGALACGLGHYTLIWGQIMGYDE-AGIKNHKSRSSPSDDQKTPLLQQEDSQV 368