BLASTX nr result
ID: Gardenia21_contig00040918
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00040918 (277 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP10130.1| unnamed protein product [Coffea canephora] 111 2e-22 >emb|CDP10130.1| unnamed protein product [Coffea canephora] Length = 2049 Score = 111 bits (278), Expect = 2e-22 Identities = 54/76 (71%), Positives = 57/76 (75%) Frame = -1 Query: 277 ANGGSIPPVSPGRRCVGSNGFLHNSSNHFLDVQVHKARTPNKFQDLEKQCFLXXXXXXXX 98 ANG S PVSPGRRCVGSNGFLHNS+NHFLDVQVHK RTPNKFQD EKQC L Sbjct: 287 ANGRSSSPVSPGRRCVGSNGFLHNSNNHFLDVQVHKVRTPNKFQDWEKQCILDDYSDEQD 346 Query: 97 XXDFGLDPGEEKDEFM 50 DF + GEEKD+FM Sbjct: 347 DEDFDIGTGEEKDDFM 362