BLASTX nr result
ID: Gardenia21_contig00040850
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00040850 (325 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO98619.1| unnamed protein product [Coffea canephora] 105 1e-20 emb|CDO98618.1| unnamed protein product [Coffea canephora] 69 1e-09 ref|XP_011086974.1| PREDICTED: probable cyclic nucleotide-gated ... 67 4e-09 ref|XP_009587296.1| PREDICTED: probable cyclic nucleotide-gated ... 65 2e-08 ref|XP_006364384.1| PREDICTED: probable cyclic nucleotide-gated ... 64 3e-08 ref|XP_007210351.1| hypothetical protein PRUPE_ppa001680mg [Prun... 62 1e-07 ref|XP_011072038.1| PREDICTED: probable cyclic nucleotide-gated ... 62 2e-07 ref|XP_011072036.1| PREDICTED: probable cyclic nucleotide-gated ... 62 2e-07 gb|AJC00855.1| cyclic nucleotide gated channel CNGC15 [Solanum l... 60 8e-07 ref|XP_012855716.1| PREDICTED: probable cyclic nucleotide-gated ... 60 8e-07 ref|XP_004299484.1| PREDICTED: probable cyclic nucleotide-gated ... 60 8e-07 ref|XP_004235383.1| PREDICTED: probable cyclic nucleotide-gated ... 60 8e-07 ref|XP_010069490.1| PREDICTED: probable cyclic nucleotide-gated ... 58 3e-06 ref|XP_010025968.1| PREDICTED: probable cyclic nucleotide-gated ... 57 5e-06 gb|KCW57855.1| hypothetical protein EUGRSUZ_H00608 [Eucalyptus g... 57 5e-06 ref|XP_008240379.1| PREDICTED: probable cyclic nucleotide-gated ... 57 7e-06 >emb|CDO98619.1| unnamed protein product [Coffea canephora] Length = 781 Score = 105 bits (262), Expect = 1e-20 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = -3 Query: 323 YQSPYWRGLAARRIQVAWRYWRKRIGRGDSSSPEHDHYSAYHHSPGY 183 YQSPYWRGLAARRIQV WRYWRKR+GRG SSSPEHDHYSAYHHSPGY Sbjct: 735 YQSPYWRGLAARRIQVGWRYWRKRLGRGGSSSPEHDHYSAYHHSPGY 781 >emb|CDO98618.1| unnamed protein product [Coffea canephora] Length = 783 Score = 69.3 bits (168), Expect = 1e-09 Identities = 30/43 (69%), Positives = 32/43 (74%) Frame = -3 Query: 323 YQSPYWRGLAARRIQVAWRYWRKRIGRGDSSSPEHDHYSAYHH 195 +QSPYWRGLA RRIQVAWRYW+KR R DS SPEH H H Sbjct: 741 HQSPYWRGLAVRRIQVAWRYWKKRQSRADSFSPEHYHTQDTDH 783 >ref|XP_011086974.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic [Sesamum indicum] Length = 773 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -3 Query: 323 YQSPYWRGLAARRIQVAWRYWRKRIGRGDSSSPEHD 216 Y+SPYWRG+AARRIQVAWRY +KR+GR DSSSP H+ Sbjct: 738 YESPYWRGIAARRIQVAWRYRKKRMGRADSSSPPHN 773 >ref|XP_009587296.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic [Nicotiana tomentosiformis] gi|697157090|ref|XP_009587297.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic [Nicotiana tomentosiformis] Length = 771 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -3 Query: 323 YQSPYWRGLAARRIQVAWRYWRKRIGRGDSSSPEH 219 Y+SPYWRGLAARRIQVAWRY +KR R DSSSP+H Sbjct: 737 YESPYWRGLAARRIQVAWRYRKKRQSRSDSSSPQH 771 >ref|XP_006364384.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like isoform X1 [Solanum tuberosum] gi|565397617|ref|XP_006364385.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like isoform X2 [Solanum tuberosum] gi|565397619|ref|XP_006364386.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like isoform X3 [Solanum tuberosum] Length = 771 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -3 Query: 323 YQSPYWRGLAARRIQVAWRYWRKRIGRGDSSSPEH 219 Y+SPYWRGLAARRIQVAWRY +KR R DSSSP+H Sbjct: 737 YESPYWRGLAARRIQVAWRYRKKRQSRTDSSSPQH 771 >ref|XP_007210351.1| hypothetical protein PRUPE_ppa001680mg [Prunus persica] gi|462406086|gb|EMJ11550.1| hypothetical protein PRUPE_ppa001680mg [Prunus persica] Length = 781 Score = 62.4 bits (150), Expect = 1e-07 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -3 Query: 323 YQSPYWRGLAARRIQVAWRYWRKRIGRGDSSSPEHDH 213 Y+SPYWRGLAARRIQVAWRY RKR+ R D+S + +H Sbjct: 739 YESPYWRGLAARRIQVAWRYRRKRLSRADTSQSQSNH 775 >ref|XP_011072038.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic isoform X2 [Sesamum indicum] Length = 733 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -3 Query: 323 YQSPYWRGLAARRIQVAWRYWRKRIGRGDSSSP 225 Y+SPYWRGLAARRIQVAWRY +KR+ R D SSP Sbjct: 693 YESPYWRGLAARRIQVAWRYRKKRLSRADDSSP 725 >ref|XP_011072036.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic isoform X1 [Sesamum indicum] gi|747051888|ref|XP_011072037.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic isoform X1 [Sesamum indicum] Length = 779 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -3 Query: 323 YQSPYWRGLAARRIQVAWRYWRKRIGRGDSSSP 225 Y+SPYWRGLAARRIQVAWRY +KR+ R D SSP Sbjct: 739 YESPYWRGLAARRIQVAWRYRKKRLSRADDSSP 771 >gb|AJC00855.1| cyclic nucleotide gated channel CNGC15 [Solanum lycopersicum] Length = 763 Score = 59.7 bits (143), Expect = 8e-07 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -3 Query: 323 YQSPYWRGLAARRIQVAWRYWRKRIGRGDSSSPE 222 Y+SPYWRGLAAR+IQVAWRY +KR R DSSSP+ Sbjct: 729 YESPYWRGLAARQIQVAWRYRKKRQSRTDSSSPQ 762 >ref|XP_012855716.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic [Erythranthe guttatus] gi|604302710|gb|EYU22267.1| hypothetical protein MIMGU_mgv1a001823mg [Erythranthe guttata] Length = 754 Score = 59.7 bits (143), Expect = 8e-07 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -3 Query: 323 YQSPYWRGLAARRIQVAWRYWRKRIGRGDSSSP 225 Y+SPYWRGLAARRIQVAWRY +KR R DSS P Sbjct: 713 YESPYWRGLAARRIQVAWRYRKKRQSRADSSGP 745 >ref|XP_004299484.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic [Fragaria vesca subsp. vesca] Length = 777 Score = 59.7 bits (143), Expect = 8e-07 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = -3 Query: 323 YQSPYWRGLAARRIQVAWRYWRKRIGRGDSSSPEHDH 213 Y+SPYWRGLAAR IQVAWRY +KR+ R D+S H H Sbjct: 740 YESPYWRGLAARCIQVAWRYRKKRLNRADTSQSNHAH 776 >ref|XP_004235383.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic [Solanum lycopersicum] Length = 771 Score = 59.7 bits (143), Expect = 8e-07 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -3 Query: 323 YQSPYWRGLAARRIQVAWRYWRKRIGRGDSSSPE 222 Y+SPYWRGLAAR+IQVAWRY +KR R DSSSP+ Sbjct: 737 YESPYWRGLAARQIQVAWRYRKKRQSRTDSSSPQ 770 >ref|XP_010069490.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic [Eucalyptus grandis] gi|629091856|gb|KCW57851.1| hypothetical protein EUGRSUZ_H00603 [Eucalyptus grandis] Length = 731 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -3 Query: 323 YQSPYWRGLAARRIQVAWRYWRKRIGRGDSSSPEH 219 Y SPYWRGLAA RIQVAWRY +K++ RGD+S +H Sbjct: 694 YVSPYWRGLAATRIQVAWRYKKKQLSRGDTSPSQH 728 >ref|XP_010025968.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic [Eucalyptus grandis] Length = 611 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = -3 Query: 323 YQSPYWRGLAARRIQVAWRYWRKRIGRGDSSSPEH 219 Y SPYWRGLAA RIQVAWRY +KR+ R D+S +H Sbjct: 574 YVSPYWRGLAATRIQVAWRYKKKRLSRSDTSPSQH 608 >gb|KCW57855.1| hypothetical protein EUGRSUZ_H00608 [Eucalyptus grandis] Length = 680 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = -3 Query: 323 YQSPYWRGLAARRIQVAWRYWRKRIGRGDSSSPEH 219 Y SPYWRGLAA RIQVAWRY +KR+ R D+S +H Sbjct: 643 YVSPYWRGLAATRIQVAWRYKKKRLSRSDTSPSQH 677 >ref|XP_008240379.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic [Prunus mume] Length = 783 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/44 (56%), Positives = 31/44 (70%) Frame = -3 Query: 323 YQSPYWRGLAARRIQVAWRYWRKRIGRGDSSSPEHDHYSAYHHS 192 Y+SPYWRGLAAR IQVAWRY RKR R D+S + ++H+ Sbjct: 739 YESPYWRGLAARFIQVAWRYRRKRQSRADTSQSQSQSNHIHNHA 782