BLASTX nr result
ID: Gardenia21_contig00040717
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00040717 (368 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009614630.1| PREDICTED: leucine aminopeptidase 2, chlorop... 68 3e-09 ref|XP_009795110.1| PREDICTED: leucine aminopeptidase 2, chlorop... 67 7e-09 ref|XP_011079411.1| PREDICTED: leucine aminopeptidase 2, chlorop... 64 6e-08 ref|NP_001233884.2| leucine aminopeptidase 2, chloroplastic [Sol... 58 3e-06 sp|Q42876.1|AMPL2_SOLLC RecName: Full=Leucine aminopeptidase 2, ... 57 5e-06 ref|XP_006350101.1| PREDICTED: leucine aminopeptidase 2, chlorop... 56 9e-06 >ref|XP_009614630.1| PREDICTED: leucine aminopeptidase 2, chloroplastic [Nicotiana tomentosiformis] Length = 579 Score = 67.8 bits (164), Expect = 3e-09 Identities = 38/60 (63%), Positives = 42/60 (70%), Gaps = 1/60 (1%) Frame = -1 Query: 188 SSSCY-SVFMRFRSKSIWCFSFSVAPLCCYSSRRAKCMAHSIAKAGLCLTQPNQIEPSKV 12 S CY SVF +F+S IW SFSV PL C SRRAK MAHSIA+A L LT PNQIE K+ Sbjct: 18 SLHCYPSVFTKFQSSPIWSISFSVTPLLC--SRRAKRMAHSIARATLGLTHPNQIEAPKI 75 >ref|XP_009795110.1| PREDICTED: leucine aminopeptidase 2, chloroplastic [Nicotiana sylvestris] Length = 576 Score = 66.6 bits (161), Expect = 7e-09 Identities = 37/60 (61%), Positives = 41/60 (68%), Gaps = 1/60 (1%) Frame = -1 Query: 188 SSSCY-SVFMRFRSKSIWCFSFSVAPLCCYSSRRAKCMAHSIAKAGLCLTQPNQIEPSKV 12 S CY SVF +F+S W SFSV PL C SRRAK MAHSIA+A L LT PNQIE K+ Sbjct: 15 SFHCYPSVFTKFKSSPTWAISFSVTPLLC--SRRAKRMAHSIARATLGLTHPNQIEAPKI 72 >ref|XP_011079411.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like [Sesamum indicum] Length = 583 Score = 63.5 bits (153), Expect = 6e-08 Identities = 37/64 (57%), Positives = 43/64 (67%), Gaps = 5/64 (7%) Frame = -1 Query: 188 SSSCY-----SVFMRFRSKSIWCFSFSVAPLCCYSSRRAKCMAHSIAKAGLCLTQPNQIE 24 SSSCY S+F +FR IW S + PL SSRRAK MAHSIA+A L LTQPN+I+ Sbjct: 20 SSSCYYHSCPSIFTKFRFGPIWAVSLTFPPL---SSRRAKRMAHSIARATLGLTQPNKID 76 Query: 23 PSKV 12 P KV Sbjct: 77 PPKV 80 >ref|NP_001233884.2| leucine aminopeptidase 2, chloroplastic [Solanum lycopersicum] gi|27463709|gb|AAO15916.1| neutral leucine aminopeptidase preprotein [Solanum lycopersicum] Length = 577 Score = 57.8 bits (138), Expect = 3e-06 Identities = 37/76 (48%), Positives = 43/76 (56%) Frame = -1 Query: 239 SNLVFSCFSCFHFFLVFSSSCYSVFMRFRSKSIWCFSFSVAPLCCYSSRRAKCMAHSIAK 60 S L S S FH S S+F +F+S IW FS SV PLC SRRAK MAHSIA+ Sbjct: 8 SALACSSSSSFH-------SYPSIFTKFQSSPIWSFSISVTPLC---SRRAKRMAHSIAR 57 Query: 59 AGLCLTQPNQIEPSKV 12 L LT NQ + K+ Sbjct: 58 DTLGLTHTNQSDAPKI 73 >sp|Q42876.1|AMPL2_SOLLC RecName: Full=Leucine aminopeptidase 2, chloroplastic; AltName: Full=Leucyl aminopeptidase 2; Short=LAP 2; AltName: Full=Proline aminopeptidase 2; AltName: Full=Prolyl aminopeptidase 2; Flags: Precursor gi|924630|gb|AAA80499.1| leucine aminopeptidase [Solanum lycopersicum] Length = 569 Score = 57.0 bits (136), Expect = 5e-06 Identities = 35/77 (45%), Positives = 45/77 (58%) Frame = -1 Query: 242 ISNLVFSCFSCFHFFLVFSSSCYSVFMRFRSKSIWCFSFSVAPLCCYSSRRAKCMAHSIA 63 ++ ++ S S FH S S+F +F+S IW FS SV PLC SRRAK MAHSIA Sbjct: 1 MNGVLCSSSSSFH-------SYPSIFTKFQSSPIWSFSISVTPLC---SRRAKRMAHSIA 50 Query: 62 KAGLCLTQPNQIEPSKV 12 + L LT NQ + K+ Sbjct: 51 RDTLGLTHTNQSDAPKI 67 >ref|XP_006350101.1| PREDICTED: leucine aminopeptidase 2, chloroplastic-like [Solanum tuberosum] Length = 577 Score = 56.2 bits (134), Expect = 9e-06 Identities = 36/76 (47%), Positives = 42/76 (55%) Frame = -1 Query: 239 SNLVFSCFSCFHFFLVFSSSCYSVFMRFRSKSIWCFSFSVAPLCCYSSRRAKCMAHSIAK 60 S L S S FH + F F +F+S IW FS SV PLC SRRAK MAHSIA+ Sbjct: 8 SALACSSSSSFHSYPSF-------FTKFQSSPIWSFSISVTPLC---SRRAKRMAHSIAR 57 Query: 59 AGLCLTQPNQIEPSKV 12 L LT NQ + K+ Sbjct: 58 DTLGLTHTNQSDAPKI 73