BLASTX nr result
ID: Gardenia21_contig00040538
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00040538 (313 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP14470.1| unnamed protein product [Coffea canephora] 45 2e-08 emb|CDP09717.1| unnamed protein product [Coffea canephora] 42 4e-06 >emb|CDP14470.1| unnamed protein product [Coffea canephora] Length = 660 Score = 44.7 bits (104), Expect(2) = 2e-08 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 74 KLAPIQWDGANDQEGNFSKWWSRI 3 K APIQWDGA DQ+G+F +WW RI Sbjct: 412 KAAPIQWDGAMDQKGDFRRWWIRI 435 Score = 40.0 bits (92), Expect(2) = 2e-08 Identities = 15/37 (40%), Positives = 25/37 (67%) Frame = -2 Query: 159 DPICNGCGENPETLERRLLDCPQVKEVWETSSNPMGW 49 DP+C CGE+ ET+E +L+C ++VW+ + P+ W Sbjct: 384 DPVCRLCGEDQETVEHLMLNCQHSQQVWKAA--PIQW 418 >emb|CDP09717.1| unnamed protein product [Coffea canephora] Length = 613 Score = 42.4 bits (98), Expect(2) = 4e-06 Identities = 16/37 (43%), Positives = 24/37 (64%) Frame = -2 Query: 159 DPICNGCGENPETLERRLLDCPQVKEVWETSSNPMGW 49 DPIC+GCGE E++E C + +EVW+ + P+ W Sbjct: 339 DPICDGCGEQEESIEHLFFQCSRAQEVWKMA--PIQW 373 Score = 34.7 bits (78), Expect(2) = 4e-06 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -3 Query: 74 KLAPIQWDGANDQEGNFSKWWS 9 K+APIQWDG +Q N WW+ Sbjct: 367 KMAPIQWDGLTEQTRNILVWWN 388