BLASTX nr result
ID: Gardenia21_contig00040501
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00040501 (478 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP20930.1| unnamed protein product [Coffea canephora] 40 8e-06 >emb|CDP20930.1| unnamed protein product [Coffea canephora] Length = 497 Score = 40.0 bits (92), Expect(2) = 8e-06 Identities = 19/42 (45%), Positives = 28/42 (66%) Frame = +3 Query: 246 YRGEPALKLS*KEMEMIAEPFKNSLVGRFPFSRPSMEIILKF 371 Y+GE A+ S + + +A PF+ +LVG+F RPS+E I KF Sbjct: 41 YKGEAAVVFSKADADKLAAPFQWALVGKFSHGRPSLEDIRKF 82 Score = 36.2 bits (82), Expect(2) = 8e-06 Identities = 18/41 (43%), Positives = 25/41 (60%) Frame = +2 Query: 356 DYSQILTSLGLKDNCLIGLLDDRHVLICPTLQEDHTRLFIR 478 D + SL LKD+ IGL+D RHVLI + D R+++R Sbjct: 78 DIRKFFASLNLKDHVSIGLMDYRHVLIKCMAEADFNRIWMR 118