BLASTX nr result
ID: Gardenia21_contig00039312
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00039312 (281 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO97382.1| unnamed protein product [Coffea canephora] 67 5e-09 >emb|CDO97382.1| unnamed protein product [Coffea canephora] Length = 465 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +3 Query: 3 QIRVKAAKMKNVFGNQDLHDNYINKFIQHLEKLQ 104 QIRVKAA+MKNVFGNQDLHDNYINKFIQHLE+ + Sbjct: 429 QIRVKAAQMKNVFGNQDLHDNYINKFIQHLERFK 462