BLASTX nr result
ID: Gardenia21_contig00039233
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00039233 (411 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP03605.1| unnamed protein product [Coffea canephora] 73 7e-11 >emb|CDP03605.1| unnamed protein product [Coffea canephora] Length = 185 Score = 73.2 bits (178), Expect = 7e-11 Identities = 43/78 (55%), Positives = 44/78 (56%), Gaps = 8/78 (10%) Frame = -2 Query: 350 MDESKIXXXXXXXXXXXVQPRTNSQWXXXXXXXXP----LCVSQFALASHACAFLPYV-- 189 MDE KI VQPRTN QW LC SQFALASHACAFLPYV Sbjct: 1 MDEPKILKLAVFLVFLVVQPRTNGQWIPRPIPPPIAPRPLCASQFALASHACAFLPYVPS 60 Query: 188 --PSPPPASLIAQHDSQK 141 PSPPP SLI +HDS K Sbjct: 61 PSPSPPPPSLIERHDSLK 78