BLASTX nr result
ID: Gardenia21_contig00039221
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00039221 (225 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME49751.1| hypothetical protein DOTSEDRAFT_68508 [Dothistrom... 63 7e-08 >gb|EME49751.1| hypothetical protein DOTSEDRAFT_68508 [Dothistroma septosporum NZE10] Length = 208 Score = 63.2 bits (152), Expect = 7e-08 Identities = 30/48 (62%), Positives = 36/48 (75%), Gaps = 3/48 (6%) Frame = -3 Query: 136 MADQLKQAQ---QSATGVGEEKWNQMSEEQKKATFDALPDSEKKGKTY 2 MADQLKQA QS G G EKWN M+E QKK T+++LP+ +KKGKTY Sbjct: 1 MADQLKQASAQAQSTAGAGTEKWNAMTEHQKKETYNSLPNDQKKGKTY 48