BLASTX nr result
ID: Gardenia21_contig00039202
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00039202 (494 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009048120.1| photosystem I reaction center subunit VIII (... 70 8e-10 ref|YP_007890383.1| photosystem I subunit VIII (chloroplast) [Ar... 69 2e-09 ref|YP_008815947.1| photosystem I subunit VIII (chloroplast) [Li... 68 3e-09 ref|YP_004940520.1| psaI gene product (chloroplast) [Boea hygrom... 68 3e-09 gb|AKZ22739.1| photosystem I subunit VIII (plastid) [Ellisia nyc... 67 4e-09 gb|AKZ22724.1| photosystem I subunit VIII (plastid) [Androsace o... 67 4e-09 ref|YP_009115905.1| photosystem I subunit VIII [Scrophularia tak... 67 5e-09 ref|YP_009166699.1| photosystem I subunit VIII (chloroplast) [Ta... 67 7e-09 gb|AKZ22750.1| photosystem I subunit VIII (plastid) [Verbascum t... 66 9e-09 ref|YP_009115692.1| photosystem I subunit VIII [Lysimachia corea... 66 9e-09 gb|AIW05783.1| photosystem I subunit VIII [Periploca sepium] 66 9e-09 ref|YP_817492.1| photosystem I subunit VIII [Coffea arabica] gi|... 66 1e-08 ref|YP_004935676.1| PSI reaction center subunit VIII (chloroplas... 66 1e-08 gb|AIS35693.1| photosystem I subunit VIII (chloroplast) [Mesembr... 65 2e-08 ref|YP_003587475.1| photosystem I reaction center subunit VIII [... 65 2e-08 ref|YP_009169775.1| photosystem I subunit VIII (chloroplast) [Mo... 65 2e-08 gb|AJE73614.1| photosystem I subunit VIII (plastid) [Solidago ca... 65 2e-08 gb|ADD30691.1| photosystem I subunit VIII protein (chloroplast) ... 65 2e-08 ref|YP_007507121.1| photosystem I subunit VIII (chloroplast) [Sa... 65 2e-08 gb|AEX37315.1| photosystem I subunit VIII (chloroplast) [Arbutus... 65 3e-08 >ref|YP_009048120.1| photosystem I reaction center subunit VIII (chloroplast) [Primula poissonii] gi|573015229|gb|AHF71811.1| photosystem I reaction center subunit VIII (chloroplast) [Primula poissonii] Length = 36 Score = 69.7 bits (169), Expect = 8e-10 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 345 MITFSFPSIFVPLVGLVFPAIAMASLFLYVQKNKI 241 MITF+FPSIFVPLVGLVFPAIAMASLFLYVQKNKI Sbjct: 1 MITFNFPSIFVPLVGLVFPAIAMASLFLYVQKNKI 35 >ref|YP_007890383.1| photosystem I subunit VIII (chloroplast) [Ardisia polysticta] gi|456367980|gb|AGG36894.1| photosystem I subunit VIII (chloroplast) [Ardisia polysticta] Length = 36 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -3 Query: 345 MITFSFPSIFVPLVGLVFPAIAMASLFLYVQKNKI 241 MITF+FPSIFVPLVGLVFPA+AMASLFLYVQKNKI Sbjct: 1 MITFNFPSIFVPLVGLVFPAMAMASLFLYVQKNKI 35 >ref|YP_008815947.1| photosystem I subunit VIII (chloroplast) [Lindenbergia philippensis] gi|290488620|gb|ADD30694.1| photosystem I subunit VIII protein (chloroplast) [Ehretia acuminata] gi|557136873|emb|CDI43928.1| photosystem I subunit VIII (chloroplast) [Lindenbergia philippensis] Length = 36 Score = 67.8 bits (164), Expect = 3e-09 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -3 Query: 345 MITFSFPSIFVPLVGLVFPAIAMASLFLYVQKNKI 241 M TF+FPSIFVPLVGLVFPAIAMASLFLYVQKNKI Sbjct: 1 MTTFNFPSIFVPLVGLVFPAIAMASLFLYVQKNKI 35 >ref|YP_004940520.1| psaI gene product (chloroplast) [Boea hygrometrica] gi|340549417|gb|AEK53239.1| photosystem I subunit VIII (chloroplast) [Boea hygrometrica] Length = 36 Score = 67.8 bits (164), Expect = 3e-09 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -3 Query: 345 MITFSFPSIFVPLVGLVFPAIAMASLFLYVQKNKI 241 M TF+FPSIFVPLVGLVFPAIAMASLFLYVQKNKI Sbjct: 1 MTTFTFPSIFVPLVGLVFPAIAMASLFLYVQKNKI 35 >gb|AKZ22739.1| photosystem I subunit VIII (plastid) [Ellisia nyctelea] Length = 36 Score = 67.4 bits (163), Expect = 4e-09 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 345 MITFSFPSIFVPLVGLVFPAIAMASLFLYVQKNKI 241 M TF+FPSIFVPLVGL+FPAIAMASLFLYVQKNKI Sbjct: 1 MTTFNFPSIFVPLVGLIFPAIAMASLFLYVQKNKI 35 >gb|AKZ22724.1| photosystem I subunit VIII (plastid) [Androsace occidentalis] Length = 36 Score = 67.4 bits (163), Expect = 4e-09 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = -3 Query: 345 MITFSFPSIFVPLVGLVFPAIAMASLFLYVQKNKI 241 MITF+FPSIFVPLVGLVFPA+AMASLFLYVQKN+I Sbjct: 1 MITFNFPSIFVPLVGLVFPAMAMASLFLYVQKNRI 35 >ref|YP_009115905.1| photosystem I subunit VIII [Scrophularia takesimensis] gi|744673749|gb|AJD00734.1| photosystem I subunit VIII [Scrophularia takesimensis] Length = 36 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = -3 Query: 345 MITFSFPSIFVPLVGLVFPAIAMASLFLYVQKNKI 241 MITF+FPSIFVPLVGLVFPA+AMASLFL+VQKNKI Sbjct: 1 MITFNFPSIFVPLVGLVFPALAMASLFLHVQKNKI 35 >ref|YP_009166699.1| photosystem I subunit VIII (chloroplast) [Tanaecium tetragonolobum] gi|924443732|gb|ALB78267.1| photosystem I subunit VIII (chloroplast) [Tanaecium tetragonolobum] Length = 36 Score = 66.6 bits (161), Expect = 7e-09 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 345 MITFSFPSIFVPLVGLVFPAIAMASLFLYVQKNKI 241 M TF+FPSIFVPLVGLVFPA+AMASLFLYVQKNKI Sbjct: 1 MTTFNFPSIFVPLVGLVFPAMAMASLFLYVQKNKI 35 >gb|AKZ22750.1| photosystem I subunit VIII (plastid) [Verbascum thapsus] Length = 36 Score = 66.2 bits (160), Expect = 9e-09 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 345 MITFSFPSIFVPLVGLVFPAIAMASLFLYVQKNKI 241 MITF FPSIFVPLVGLVFPA+AMASLFL+VQKNKI Sbjct: 1 MITFHFPSIFVPLVGLVFPALAMASLFLHVQKNKI 35 >ref|YP_009115692.1| photosystem I subunit VIII [Lysimachia coreana] gi|743182474|gb|AJC00279.1| photosystem I subunit VIII [Lysimachia coreana] Length = 36 Score = 66.2 bits (160), Expect = 9e-09 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -3 Query: 345 MITFSFPSIFVPLVGLVFPAIAMASLFLYVQKNKI 241 MI F+FPSIFVPLVGLVFPA+AMASLFLYVQKNK+ Sbjct: 1 MINFNFPSIFVPLVGLVFPAMAMASLFLYVQKNKV 35 >gb|AIW05783.1| photosystem I subunit VIII [Periploca sepium] Length = 36 Score = 66.2 bits (160), Expect = 9e-09 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 345 MITFSFPSIFVPLVGLVFPAIAMASLFLYVQKNKI 241 M TFSFPSIFVPLVGLVFPAIAM+SLFL+VQKNKI Sbjct: 1 MTTFSFPSIFVPLVGLVFPAIAMSSLFLFVQKNKI 35 >ref|YP_817492.1| photosystem I subunit VIII [Coffea arabica] gi|122153630|sp|A0A345.1|PSAI_COFAR RecName: Full=Photosystem I reaction center subunit VIII; Short=PSI-I gi|116242174|gb|ABJ89689.1| photosystem I subunit VIII [Coffea arabica] Length = 36 Score = 65.9 bits (159), Expect = 1e-08 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -3 Query: 345 MITFSFPSIFVPLVGLVFPAIAMASLFLYVQKNKI 241 MITFSFPSIFVPLVGLVFPAIAMASL L+VQKNKI Sbjct: 1 MITFSFPSIFVPLVGLVFPAIAMASLSLHVQKNKI 35 >ref|YP_004935676.1| PSI reaction center subunit VIII (chloroplast) [Sesamum indicum] gi|442742973|ref|YP_007353925.1| photosystem I subunit VIII (chloroplast) [Tectona grandis] gi|568247084|ref|YP_008964044.1| photosystem I subunit VIII [Ajuga reptans] gi|752789796|ref|YP_009117231.1| photosystem I subunit VIII (chloroplast) [Premna microphylla] gi|110456614|gb|ABG74741.1| PSI reaction center subunit VIII [Forsythia europaea] gi|347448305|gb|AEO92716.1| PSI reaction center subunit VIII (chloroplast) [Sesamum indicum] gi|410176164|gb|AFV61823.1| PSI reaction center subunit VIII (chloroplast) [Origanum vulgare subsp. vulgare] gi|438687614|emb|CCP47140.1| photosystem I subunit VIII (chloroplast) [Tectona grandis] gi|438688298|emb|CCP47229.1| photosystem I subunit VIII (chloroplast) [Tectona grandis] gi|438688422|emb|CCP47318.1| photosystem I subunit VIII (chloroplast) [Tectona grandis] gi|496538611|gb|AGL45346.1| PsaI (chloroplast) [Sesamum indicum] gi|558697155|gb|AHA84910.1| photosystem I subunit VIII [Ajuga reptans] gi|748013914|gb|AJE28384.1| photosystem I subunit VIII (chloroplast) [Premna microphylla] gi|916440081|gb|AKZ22745.1| photosystem I subunit VIII (plastid) [Monarda fistulosa var. mollis] gi|916440085|gb|AKZ22747.1| photosystem I subunit VIII (plastid) [Nepeta cataria] gi|916440093|gb|AKZ22751.1| photosystem I subunit VIII (plastid) [Teucrium canadense] gi|916440095|gb|AKZ22752.1| photosystem I subunit VIII (plastid) [Verbena hastata] Length = 36 Score = 65.9 bits (159), Expect = 1e-08 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 345 MITFSFPSIFVPLVGLVFPAIAMASLFLYVQKNKI 241 M TF+FPSIFVPLVGLVFPAIAMASLFL+VQKNKI Sbjct: 1 MTTFNFPSIFVPLVGLVFPAIAMASLFLHVQKNKI 35 >gb|AIS35693.1| photosystem I subunit VIII (chloroplast) [Mesembryanthemum crystallinum] Length = 36 Score = 65.5 bits (158), Expect = 2e-08 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -3 Query: 345 MITFSFPSIFVPLVGLVFPAIAMASLFLYVQKNKI 241 M T +FPSIFVPLVGLVFPAIAMASLFLYVQKNKI Sbjct: 1 MTTINFPSIFVPLVGLVFPAIAMASLFLYVQKNKI 35 >ref|YP_003587475.1| photosystem I reaction center subunit VIII [Oncidium hybrid cultivar] gi|254833116|gb|ACT83119.1| photosystem I reaction center subunit VIII [Oncidium hybrid cultivar] Length = 62 Score = 65.5 bits (158), Expect = 2e-08 Identities = 41/68 (60%), Positives = 47/68 (69%), Gaps = 4/68 (5%) Frame = -3 Query: 345 MITFSFPSIFVPLVGLVFPAIAMASLFLYVQKNKIS*IRWDPISSIFSKLRFVS*HRH-- 172 MI +FPSIFVPLVGLVFPAIAMASLFLYVQ+NKI ++D I S +F+S H Sbjct: 1 MIDLNFPSIFVPLVGLVFPAIAMASLFLYVQRNKI--YKYDGIKS----HQFLSTLDHHT 54 Query: 171 --LFSRIW 154 FS IW Sbjct: 55 DIFFSAIW 62 >ref|YP_009169775.1| photosystem I subunit VIII (chloroplast) [Morinda officinalis] gi|927029375|gb|ALD61671.1| photosystem I subunit VIII (chloroplast) [Morinda officinalis] Length = 36 Score = 65.1 bits (157), Expect = 2e-08 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -3 Query: 345 MITFSFPSIFVPLVGLVFPAIAMASLFLYVQKNKIS 238 M TFSFPSIFVPLVGLVFPAIAMASL L+VQKNK+S Sbjct: 1 MTTFSFPSIFVPLVGLVFPAIAMASLSLHVQKNKVS 36 >gb|AJE73614.1| photosystem I subunit VIII (plastid) [Solidago canadensis var. scabra] gi|748994510|gb|AJE74906.1| photosystem I subunit VIII (plastid) [Solidago gigantea] gi|916440059|gb|AKZ22734.1| photosystem I subunit VIII (plastid) [Solidago missouriensis] gi|917546015|gb|AKZ31349.1| photosystem I subunit VIII (chloroplast) [Coopernookia polygalacea] gi|917546082|gb|AKZ31415.1| photosystem I subunit VIII (chloroplast) [Coopernookia strophiolata] Length = 36 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 345 MITFSFPSIFVPLVGLVFPAIAMASLFLYVQKNKI 241 M TF+FPS+ VPLVGLVFPAIAMASLFLYVQKNKI Sbjct: 1 MTTFNFPSVLVPLVGLVFPAIAMASLFLYVQKNKI 35 >gb|ADD30691.1| photosystem I subunit VIII protein (chloroplast) [Antirrhinum majus] Length = 36 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -3 Query: 345 MITFSFPSIFVPLVGLVFPAIAMASLFLYVQKNKI 241 M TF+FPSIFVPLVGLVFPA+AMASLFL+VQKNKI Sbjct: 1 MTTFNFPSIFVPLVGLVFPALAMASLFLHVQKNKI 35 >ref|YP_007507121.1| photosystem I subunit VIII (chloroplast) [Salvia miltiorrhiza] gi|910312610|ref|YP_009162271.1| photosystem I subunit VIII (chloroplast) [Scutellaria baicalensis] gi|110456710|gb|ABG74813.1| PSI reaction center subunit VIII [Jasminum subhumile] gi|401879752|gb|AFQ30939.1| photosystem I subunit VIII (chloroplast) [Salvia miltiorrhiza] gi|573461961|emb|CCQ71630.1| photosystem I subunit VIII (chloroplast) [Salvia miltiorrhiza] gi|827345908|gb|AKJ77209.1| photosystem I subunit VIII (chloroplast) [Scutellaria baicalensis] gi|916440083|gb|AKZ22746.1| photosystem I subunit VIII (plastid) [Salvia nemorosa] gi|949600162|gb|ALN11613.1| photosystem I subunit VIII (chloroplast) [Scutellaria insignis] Length = 36 Score = 65.1 bits (157), Expect = 2e-08 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -3 Query: 345 MITFSFPSIFVPLVGLVFPAIAMASLFLYVQKNKI 241 M TF FPSIFVPLVGLVFPAIAMASLFL+VQKNKI Sbjct: 1 MTTFHFPSIFVPLVGLVFPAIAMASLFLHVQKNKI 35 >gb|AEX37315.1| photosystem I subunit VIII (chloroplast) [Arbutus unedo] Length = 36 Score = 64.7 bits (156), Expect = 3e-08 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 345 MITFSFPSIFVPLVGLVFPAIAMASLFLYVQKNKI 241 MITF+FPSIFVPLVGLVFPAIAMASL L+VQKNKI Sbjct: 1 MITFNFPSIFVPLVGLVFPAIAMASLSLHVQKNKI 35