BLASTX nr result
ID: Gardenia21_contig00039163
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00039163 (312 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP05732.1| unnamed protein product [Coffea canephora] 184 2e-44 >emb|CDP05732.1| unnamed protein product [Coffea canephora] Length = 809 Score = 184 bits (467), Expect = 2e-44 Identities = 92/103 (89%), Positives = 98/103 (95%) Frame = -3 Query: 310 NGFYQSSSERDFSCEKPRTMKLLGQSLKQENTTRQTPKTQDLINKRSCRKVSHDKCLKPE 131 N FYQSSSERDFSCEKPRT+ LLGQSLKQENTTR+TPKT+DLINKRSC+KVSHDKCLKP Sbjct: 371 NVFYQSSSERDFSCEKPRTINLLGQSLKQENTTRETPKTEDLINKRSCKKVSHDKCLKPG 430 Query: 130 ILMGKISRRQGLLSEISKTGVLLVESEKKQILLRELMNESLAQ 2 ILMGKISRRQGLLSEISKTGVLLVESEKKQILL+ELMN +L Q Sbjct: 431 ILMGKISRRQGLLSEISKTGVLLVESEKKQILLQELMNNNLTQ 473