BLASTX nr result
ID: Gardenia21_contig00039038
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00039038 (342 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO98689.1| unnamed protein product [Coffea canephora] 61 4e-07 >emb|CDO98689.1| unnamed protein product [Coffea canephora] Length = 344 Score = 60.8 bits (146), Expect = 4e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -3 Query: 97 WWLADPLVGVP*FANVSGESLATIKCSCCSFL 2 WWL DP VGVP FAN+SGESL +IKCSCCSFL Sbjct: 4 WWLPDPPVGVPSFANLSGESLPSIKCSCCSFL 35