BLASTX nr result
ID: Gardenia21_contig00038970
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00038970 (533 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO98959.1| unnamed protein product [Coffea canephora] 117 3e-24 >emb|CDO98959.1| unnamed protein product [Coffea canephora] Length = 419 Score = 117 bits (294), Expect = 3e-24 Identities = 55/59 (93%), Positives = 58/59 (98%) Frame = -1 Query: 533 FVVSANSDSSEGKTRSDALRKENGTSDIFFTPSGSEICHSVRSDFSERYSYQNTMPKDQ 357 FVVSANSDS+EGKTRSDALR ENGTSD+FFTPSGSE+CHSVRSDFSERYSYQNTMPKDQ Sbjct: 349 FVVSANSDSNEGKTRSDALRTENGTSDVFFTPSGSEVCHSVRSDFSERYSYQNTMPKDQ 407