BLASTX nr result
ID: Gardenia21_contig00038957
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00038957 (227 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO98128.1| unnamed protein product [Coffea canephora] 64 6e-08 >emb|CDO98128.1| unnamed protein product [Coffea canephora] Length = 693 Score = 63.5 bits (153), Expect = 6e-08 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 3/39 (7%) Frame = -1 Query: 227 RAALKGHKFETRVMAAIDACLSEGSKGASTS---RRHKR 120 RAALKGHKFET+VMAAIDACLSEGS+GAS++ RRHKR Sbjct: 655 RAALKGHKFETQVMAAIDACLSEGSRGASSTNSRRRHKR 693