BLASTX nr result
ID: Gardenia21_contig00038497
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00038497 (335 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010102818.1| hypothetical protein L484_004672 [Morus nota... 63 8e-08 >ref|XP_010102818.1| hypothetical protein L484_004672 [Morus notabilis] gi|587906044|gb|EXB94146.1| hypothetical protein L484_004672 [Morus notabilis] Length = 135 Score = 63.2 bits (152), Expect = 8e-08 Identities = 29/43 (67%), Positives = 32/43 (74%) Frame = +1 Query: 10 RVSRVRPDSDPNPSILDPNPLFSC*IRVVFSDRVGNCHPYP*P 138 RVSRVRPD DPN +++PNPLFSC RVV S R NCHPY P Sbjct: 27 RVSRVRPDFDPNLFMINPNPLFSCRFRVVLSCRYSNCHPYSRP 69