BLASTX nr result
ID: Gardenia21_contig00038467
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00038467 (616 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO66838.1| hypothetical protein CISIN_1g010343mg [Citrus sin... 60 1e-06 ref|XP_006410024.1| hypothetical protein EUTSA_v10016491mg [Eutr... 60 1e-06 >gb|KDO66838.1| hypothetical protein CISIN_1g010343mg [Citrus sinensis] gi|641847961|gb|KDO66839.1| hypothetical protein CISIN_1g010343mg [Citrus sinensis] Length = 483 Score = 59.7 bits (143), Expect = 1e-06 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -2 Query: 597 SVLVSFLKQGTDAFSQSGLYSNHQDIAPRYSVSIILV 487 +VL QGTDAFSQSGLYSNHQDIAPRYSVSII + Sbjct: 422 AVLCMACSQGTDAFSQSGLYSNHQDIAPRYSVSIISI 458 >ref|XP_006410024.1| hypothetical protein EUTSA_v10016491mg [Eutrema salsugineum] gi|557111193|gb|ESQ51477.1| hypothetical protein EUTSA_v10016491mg [Eutrema salsugineum] Length = 537 Score = 59.7 bits (143), Expect = 1e-06 Identities = 33/48 (68%), Positives = 35/48 (72%) Frame = -2 Query: 597 SVLVSFLKQGTDAFSQSGLYSNHQDIAPRYSVSIILVQSNFIKSKATQ 454 +VL QG DAFSQSGLYSNHQDIAPRYSVSII + F S ATQ Sbjct: 420 AVLCMACSQGLDAFSQSGLYSNHQDIAPRYSVSII---NYFFTSHATQ 464