BLASTX nr result
ID: Gardenia21_contig00038462
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00038462 (617 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP07495.1| unnamed protein product [Coffea canephora] 61 4e-07 ref|XP_009771197.1| PREDICTED: uncharacterized protein LOC104221... 59 3e-06 >emb|CDP07495.1| unnamed protein product [Coffea canephora] Length = 118 Score = 61.2 bits (147), Expect = 4e-07 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -1 Query: 431 MGGRTFVLILFFWAVLTIVTPMLVRWSASAKP 336 M GRTFVLILFFWAVLTIVTPMLVR SASAKP Sbjct: 1 MSGRTFVLILFFWAVLTIVTPMLVRLSASAKP 32 >ref|XP_009771197.1| PREDICTED: uncharacterized protein LOC104221766 [Nicotiana sylvestris] Length = 90 Score = 58.5 bits (140), Expect = 3e-06 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -1 Query: 431 MGGRTFVLILFFWAVLTIVTPMLVRWSASAKPQG 330 M GRTF+LILFFWAVLTIVTP+LVR SASAK G Sbjct: 1 MSGRTFILILFFWAVLTIVTPVLVRLSASAKANG 34