BLASTX nr result
ID: Gardenia21_contig00038461
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00038461 (240 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009589046.1| PREDICTED: extensin-2-like [Nicotiana toment... 59 1e-06 >ref|XP_009589046.1| PREDICTED: extensin-2-like [Nicotiana tomentosiformis] Length = 880 Score = 58.9 bits (141), Expect = 1e-06 Identities = 30/42 (71%), Positives = 34/42 (80%), Gaps = 3/42 (7%) Frame = -2 Query: 119 MRLQGGDPGRGR---LLLVALAILGVSVVVSADPYVYSSPPP 3 MRL GGDP RGR +LVALAIL V+ +VSADPYVY+SPPP Sbjct: 1 MRLNGGDPRRGRHVPQILVALAILAVANIVSADPYVYASPPP 42