BLASTX nr result
ID: Gardenia21_contig00038435
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00038435 (362 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP04209.1| unnamed protein product [Coffea canephora] 58 2e-06 >emb|CDP04209.1| unnamed protein product [Coffea canephora] Length = 169 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +2 Query: 2 SDDNLKSPSGLLAVPKVQRLFKNFKNLSQLF 94 SDDNLKSPS LLA PK+Q+LFKNFKNLSQLF Sbjct: 64 SDDNLKSPSRLLAAPKIQKLFKNFKNLSQLF 94