BLASTX nr result
ID: Gardenia21_contig00038346
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00038346 (391 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP12858.1| unnamed protein product [Coffea canephora] 138 1e-30 ref|XP_007022156.1| Encodes a root meristem growth factor, Belon... 69 1e-09 gb|KJB11834.1| hypothetical protein B456_002G039200 [Gossypium r... 66 9e-09 gb|KHF97894.1| Root meristem growth factor 9 -like protein [Goss... 66 9e-09 ref|XP_006380481.1| hypothetical protein POPTR_0007s07020g [Popu... 66 9e-09 ref|XP_007048186.1| Encodes a root meristem growth factor, Belon... 64 3e-08 >emb|CDP12858.1| unnamed protein product [Coffea canephora] Length = 72 Score = 138 bits (348), Expect = 1e-30 Identities = 68/72 (94%), Positives = 69/72 (95%) Frame = -1 Query: 373 MAVVPKKHTLLMASFLLCFLIVTAQARSVPRESRGAEKADDKMLSTTKEVPTSEELEMMD 194 MAV PKKHTLLMASFLLCFL+VTAQARS PRESRG EKADDKMLSTTKEVPTSEELEMMD Sbjct: 1 MAVAPKKHTLLMASFLLCFLLVTAQARSTPRESRGVEKADDKMLSTTKEVPTSEELEMMD 60 Query: 193 YSPARKKTPIHN 158 YSPARKKTPIHN Sbjct: 61 YSPARKKTPIHN 72 >ref|XP_007022156.1| Encodes a root meristem growth factor, Belongs to a family of functionally redundant ous peptides that are secreted, putative [Theobroma cacao] gi|508721784|gb|EOY13681.1| Encodes a root meristem growth factor, Belongs to a family of functionally redundant ous peptides that are secreted, putative [Theobroma cacao] Length = 75 Score = 68.9 bits (167), Expect = 1e-09 Identities = 37/75 (49%), Positives = 52/75 (69%), Gaps = 3/75 (4%) Frame = -1 Query: 373 MAVVPKKHTLLMASFLLCFLIVTAQARSVPRESRGAEKA-DDKMLSTTKEVPTS--EELE 203 M V +KH LL+A LLCF+ TA+A+S+P+E+R EK DD++L+ E S +EL Sbjct: 1 MTRVSRKHYLLVAFLLLCFISTTARAQSLPKEARETEKGHDDQVLTAATEDGASNVDELV 60 Query: 202 MMDYSPARKKTPIHN 158 +DY+PAR+K PIHN Sbjct: 61 AVDYTPARRKPPIHN 75 >gb|KJB11834.1| hypothetical protein B456_002G039200 [Gossypium raimondii] Length = 73 Score = 66.2 bits (160), Expect = 9e-09 Identities = 36/75 (48%), Positives = 48/75 (64%), Gaps = 3/75 (4%) Frame = -1 Query: 373 MAVVPKKHTLLMASFLLCFLIVTAQARSVPRESRGAEKADDKMLSTTKE---VPTSEELE 203 MA VP KH LL+ LCF+ T ARS+P E + + DD++++T E P +ELE Sbjct: 1 MARVPCKHVLLIVFIFLCFISTTPIARSLPSEMK--KGLDDRVVTTENEGGAPPDVDELE 58 Query: 202 MMDYSPARKKTPIHN 158 MDY+PAR+K PIHN Sbjct: 59 AMDYTPARRKPPIHN 73 >gb|KHF97894.1| Root meristem growth factor 9 -like protein [Gossypium arboreum] Length = 73 Score = 66.2 bits (160), Expect = 9e-09 Identities = 36/75 (48%), Positives = 48/75 (64%), Gaps = 3/75 (4%) Frame = -1 Query: 373 MAVVPKKHTLLMASFLLCFLIVTAQARSVPRESRGAEKADDKMLSTTKE---VPTSEELE 203 MA VP KH LL+ LCF+ T ARS+P E + + DD++++T E P +ELE Sbjct: 1 MARVPCKHVLLIVFIFLCFISTTPIARSLPSEMK--KGLDDRVVTTENEGGAPPDVDELE 58 Query: 202 MMDYSPARKKTPIHN 158 MDY+PAR+K PIHN Sbjct: 59 SMDYTPARRKPPIHN 73 >ref|XP_006380481.1| hypothetical protein POPTR_0007s07020g [Populus trichocarpa] gi|550334303|gb|ERP58278.1| hypothetical protein POPTR_0007s07020g [Populus trichocarpa] Length = 75 Score = 66.2 bits (160), Expect = 9e-09 Identities = 37/75 (49%), Positives = 49/75 (65%), Gaps = 3/75 (4%) Frame = -1 Query: 373 MAVVPKKHTLLMASFLLCFLIVTAQARSVPRESR-GAEKADDKMLSTTKE--VPTSEELE 203 MA + + H +L+A FLLCF+ A+AR++ S GAEK D + +KE +P EEL Sbjct: 1 MAKISRNHLVLVAFFLLCFVSTCARARTLREASNHGAEKKDQNDMFPSKENGLPDVEELV 60 Query: 202 MMDYSPARKKTPIHN 158 MDY+PARKK PIHN Sbjct: 61 GMDYTPARKKPPIHN 75 >ref|XP_007048186.1| Encodes a root meristem growth factor, Belongs to a family of functionally redundant ous peptides that are secreted, putative [Theobroma cacao] gi|508700447|gb|EOX92343.1| Encodes a root meristem growth factor, Belongs to a family of functionally redundant ous peptides that are secreted, putative [Theobroma cacao] Length = 75 Score = 64.3 bits (155), Expect = 3e-08 Identities = 34/75 (45%), Positives = 48/75 (64%), Gaps = 3/75 (4%) Frame = -1 Query: 373 MAVVPKKHTLLMASFLLCFLIVTAQARSVPRESRGAEKADDKMLSTTKEVP---TSEELE 203 MA VP KH LL+A FL CF+ TA AR++P + DD++L+ T++ ++EL Sbjct: 1 MARVPCKHLLLVALFLFCFISTTAGARNMPVAKETQKVHDDQVLTATEDGAPKINADELV 60 Query: 202 MMDYSPARKKTPIHN 158 MDY+PA +K PIHN Sbjct: 61 SMDYTPATRKPPIHN 75