BLASTX nr result
ID: Gardenia21_contig00038276
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00038276 (287 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO99090.1| unnamed protein product [Coffea canephora] 79 1e-12 >emb|CDO99090.1| unnamed protein product [Coffea canephora] Length = 574 Score = 79.3 bits (194), Expect = 1e-12 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -2 Query: 118 MPSGLKLFHSFWHFRARISSTRLSTDVRYVSDGNHFLWN 2 MPS L+LFHSFWHFRARISS+R +TDVRYVSDGNHFLWN Sbjct: 1 MPSRLRLFHSFWHFRARISSSRFTTDVRYVSDGNHFLWN 39