BLASTX nr result
ID: Gardenia21_contig00038256
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00038256 (356 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP00689.1| unnamed protein product [Coffea canephora] 88 1e-20 emb|CDP00686.1| unnamed protein product [Coffea canephora] 87 3e-20 emb|CDP00685.1| unnamed protein product [Coffea canephora] 84 4e-19 emb|CDP21315.1| unnamed protein product [Coffea canephora] 83 9e-14 >emb|CDP00689.1| unnamed protein product [Coffea canephora] Length = 468 Score = 87.8 bits (216), Expect(2) = 1e-20 Identities = 49/64 (76%), Positives = 53/64 (82%), Gaps = 1/64 (1%) Frame = -1 Query: 218 EILNIKIMQAKLFIEKVGEVIRVLEMEGPSTLSDQLAEDTALLALPIGDCVRRT-GVLTS 42 +ILNIK++QAKLFIEKVGEVIRVLEMEGP TL DQL ED A LALPIGD VRRT +TS Sbjct: 43 KILNIKVLQAKLFIEKVGEVIRVLEMEGPPTLPDQLLEDIAPLALPIGDFVRRTKPQITS 102 Query: 41 LSID 30 S D Sbjct: 103 PSYD 106 Score = 38.5 bits (88), Expect(2) = 1e-20 Identities = 22/33 (66%), Positives = 26/33 (78%), Gaps = 1/33 (3%) Frame = -2 Query: 313 GLTSTEGKMACDGVV-SLVKELDELIVILHKIV 218 GLT TEGKMA D VV +LV+E+DEL IL KI+ Sbjct: 13 GLTLTEGKMANDEVVYTLVEEVDELTTILRKIL 45 >emb|CDP00686.1| unnamed protein product [Coffea canephora] Length = 408 Score = 87.0 bits (214), Expect(2) = 3e-20 Identities = 44/57 (77%), Positives = 49/57 (85%) Frame = -1 Query: 218 EILNIKIMQAKLFIEKVGEVIRVLEMEGPSTLSDQLAEDTALLALPIGDCVRRTGVL 48 +ILNIK++QAKLFIEKVGEVIR+LEMEGP TL DQL ED A LALPIGD RRT +L Sbjct: 41 KILNIKVLQAKLFIEKVGEVIRILEMEGPPTLPDQLVEDIAPLALPIGDFARRTKLL 97 Score = 38.1 bits (87), Expect(2) = 3e-20 Identities = 20/29 (68%), Positives = 25/29 (86%), Gaps = 1/29 (3%) Frame = -2 Query: 301 TEGKMACDGVVSL-VKELDELIVILHKIV 218 TEGKMA D +VSL V+E+DELI I+HKI+ Sbjct: 15 TEGKMANDEIVSLLVEEVDELITIVHKIL 43 >emb|CDP00685.1| unnamed protein product [Coffea canephora] Length = 102 Score = 83.6 bits (205), Expect(2) = 4e-19 Identities = 42/54 (77%), Positives = 46/54 (85%) Frame = -1 Query: 218 EILNIKIMQAKLFIEKVGEVIRVLEMEGPSTLSDQLAEDTALLALPIGDCVRRT 57 +ILNIK++QAKLFIEKVGEVIRVLE EGP TL DQL ED A LALP+GD RRT Sbjct: 43 KILNIKVLQAKLFIEKVGEVIRVLETEGPPTLPDQLVEDIAPLALPVGDFARRT 96 Score = 37.7 bits (86), Expect(2) = 4e-19 Identities = 21/33 (63%), Positives = 26/33 (78%), Gaps = 1/33 (3%) Frame = -2 Query: 313 GLTSTEGKMACDGVVS-LVKELDELIVILHKIV 218 GLT EGKMA D ++S LV+E+DELI IL KI+ Sbjct: 13 GLTLIEGKMANDEILSLLVEEVDELITILRKIL 45 >emb|CDP21315.1| unnamed protein product [Coffea canephora] Length = 572 Score = 82.8 bits (203), Expect = 9e-14 Identities = 43/54 (79%), Positives = 46/54 (85%) Frame = -1 Query: 218 EILNIKIMQAKLFIEKVGEVIRVLEMEGPSTLSDQLAEDTALLALPIGDCVRRT 57 +ILNIK++QAKLFIEKV EVIRVLEMEGP TL DQL ED A LALPIGD RRT Sbjct: 38 KILNIKVLQAKLFIEKVVEVIRVLEMEGPPTLPDQLVEDIAPLALPIGDFARRT 91