BLASTX nr result
ID: Gardenia21_contig00038244
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00038244 (405 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP18959.1| unnamed protein product [Coffea canephora] 70 6e-10 ref|XP_012855653.1| PREDICTED: putative late blight resistance p... 61 4e-07 emb|CDP00590.1| unnamed protein product [Coffea canephora] 60 8e-07 ref|XP_011072005.1| PREDICTED: putative late blight resistance p... 59 1e-06 ref|XP_011072124.1| PREDICTED: putative late blight resistance p... 57 4e-06 >emb|CDP18959.1| unnamed protein product [Coffea canephora] Length = 890 Score = 70.1 bits (170), Expect = 6e-10 Identities = 35/81 (43%), Positives = 52/81 (64%) Frame = -1 Query: 243 MENVPDSVWEFILTNLKEQIDYHYHLITEAKGNSEELTVSIDTLKGFLKEYTKERYRQND 64 M N+PD+ FIL NLKE + Y+ LI K N +EL ++TL+ F++EYT ++Y N+ Sbjct: 1 MANIPDAALGFILQNLKESVQYNTELIGGVKDNVKELCEDLETLRAFIREYT-DKYSDNE 59 Query: 63 YLKSITDEIRRQVLQAENIIE 1 L+ + EIR V +AE+ IE Sbjct: 60 ILEKLASEIRGVVYRAEDAIE 80 >ref|XP_012855653.1| PREDICTED: putative late blight resistance protein homolog R1A-10 [Erythranthe guttatus] Length = 889 Score = 60.8 bits (146), Expect = 4e-07 Identities = 31/76 (40%), Positives = 51/76 (67%) Frame = -1 Query: 228 DSVWEFILTNLKEQIDYHYHLITEAKGNSEELTVSIDTLKGFLKEYTKERYRQNDYLKSI 49 D+ EF+L NL++ + YH HLI++AK E+L + K FLK+ TK+R R++D L+ + Sbjct: 3 DAAVEFLLENLQQLLLYHAHLISDAKNQVEKLEKDLRLFKAFLKDSTKKR-RKDDSLREL 61 Query: 48 TDEIRRQVLQAENIIE 1 +IR V +AE++I+ Sbjct: 62 VRQIRDVVYEAEDVID 77 >emb|CDP00590.1| unnamed protein product [Coffea canephora] Length = 899 Score = 59.7 bits (143), Expect = 8e-07 Identities = 27/79 (34%), Positives = 51/79 (64%) Frame = -1 Query: 237 NVPDSVWEFILTNLKEQIDYHYHLITEAKGNSEELTVSIDTLKGFLKEYTKERYRQNDYL 58 +VPD+ F+L NL++ + Y+YHLI + + N L ++TLK +++Y++ + +D+L Sbjct: 2 SVPDAAVTFLLDNLRQVLSYNYHLIADVRDNILILCQELETLKALMRDYSRYNH-DSDFL 60 Query: 57 KSITDEIRRQVLQAENIIE 1 K + EI+ V QAE+ ++ Sbjct: 61 KELVKEIKTVVNQAEDAVD 79 >ref|XP_011072005.1| PREDICTED: putative late blight resistance protein homolog R1A-10 [Sesamum indicum] Length = 886 Score = 58.9 bits (141), Expect = 1e-06 Identities = 30/76 (39%), Positives = 51/76 (67%) Frame = -1 Query: 228 DSVWEFILTNLKEQIDYHYHLITEAKGNSEELTVSIDTLKGFLKEYTKERYRQNDYLKSI 49 D+ EF+L NL++ + YH HLI++AK E+L + K FL++ TK+R R+++ L+ + Sbjct: 3 DAAVEFLLDNLQQLLIYHTHLISDAKNQVEKLESDLRLFKAFLRDSTKKR-RKDESLREL 61 Query: 48 TDEIRRQVLQAENIIE 1 +IR V +AE+II+ Sbjct: 62 VRQIRDVVYEAEDIID 77 >ref|XP_011072124.1| PREDICTED: putative late blight resistance protein homolog R1B-14 [Sesamum indicum] Length = 636 Score = 57.4 bits (137), Expect = 4e-06 Identities = 29/76 (38%), Positives = 50/76 (65%) Frame = -1 Query: 228 DSVWEFILTNLKEQIDYHYHLITEAKGNSEELTVSIDTLKGFLKEYTKERYRQNDYLKSI 49 D+ +F+L NL++ + YH HLI +AK E+L ++ FLK+ TK+R R+++ L+ + Sbjct: 3 DAAVQFLLDNLQQLLIYHTHLIADAKNQVEKLESNLRVFNAFLKDSTKKR-RKDESLREL 61 Query: 48 TDEIRRQVLQAENIIE 1 +IR V +AE+II+ Sbjct: 62 VRQIRDVVYEAEDIID 77