BLASTX nr result
ID: Gardenia21_contig00038232
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00038232 (377 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB14977.1| hypothetical protein B456_002G152900 [Gossypium r... 57 7e-06 >gb|KJB14977.1| hypothetical protein B456_002G152900 [Gossypium raimondii] Length = 63 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/46 (63%), Positives = 36/46 (78%) Frame = -1 Query: 362 MAQASNLKAFLVAMVLAMFSTASAQELLAPAPSPDAGAAFSLPVAT 225 MAQ S LKAFL+A V+A+ + ASAQ AP+PSPDAGA FS+ V+T Sbjct: 1 MAQVSMLKAFLLAFVMAILTVASAQVSEAPSPSPDAGAGFSVGVST 46