BLASTX nr result
ID: Gardenia21_contig00038119
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00038119 (263 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP15103.1| unnamed protein product [Coffea canephora] 173 4e-41 ref|XP_010673320.1| PREDICTED: pentatricopeptide repeat-containi... 123 5e-26 ref|XP_007221312.1| hypothetical protein PRUPE_ppa026098mg [Prun... 119 7e-25 ref|XP_012078458.1| PREDICTED: pentatricopeptide repeat-containi... 119 9e-25 ref|XP_010251317.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 119 1e-24 ref|XP_008222743.1| PREDICTED: pentatricopeptide repeat-containi... 119 1e-24 ref|XP_002298671.2| pentatricopeptide repeat-containing family p... 118 2e-24 ref|XP_002520617.1| pentatricopeptide repeat-containing protein,... 117 3e-24 ref|XP_011045810.1| PREDICTED: pentatricopeptide repeat-containi... 117 3e-24 ref|XP_012844493.1| PREDICTED: pentatricopeptide repeat-containi... 115 2e-23 gb|EYU31519.1| hypothetical protein MIMGU_mgv1a003519mg [Erythra... 115 2e-23 ref|XP_006421034.1| hypothetical protein CICLE_v10004567mg [Citr... 115 2e-23 gb|KDO47448.1| hypothetical protein CISIN_1g037713mg [Citrus sin... 114 3e-23 ref|XP_006492529.1| PREDICTED: pentatricopeptide repeat-containi... 114 3e-23 ref|XP_006492528.1| PREDICTED: pentatricopeptide repeat-containi... 114 3e-23 ref|XP_011071982.1| PREDICTED: pentatricopeptide repeat-containi... 114 4e-23 ref|XP_004247893.1| PREDICTED: pentatricopeptide repeat-containi... 113 5e-23 ref|XP_009373569.1| PREDICTED: pentatricopeptide repeat-containi... 112 8e-23 ref|XP_002278647.1| PREDICTED: pentatricopeptide repeat-containi... 112 8e-23 ref|XP_008380458.1| PREDICTED: pentatricopeptide repeat-containi... 111 2e-22 >emb|CDP15103.1| unnamed protein product [Coffea canephora] Length = 611 Score = 173 bits (439), Expect = 4e-41 Identities = 81/87 (93%), Positives = 86/87 (98%) Frame = +2 Query: 2 NVLIDLYGKCGLIQDAVKVFEKMPHRDLFSWASVLTAYNQAELPHRTLCLFTKMSFLDYL 181 NVLIDLYGKCGL+QDA+KVF KMPHRDLFSWAS+LTAYNQA+LPHRTLCLFTKMS+LDYL Sbjct: 43 NVLIDLYGKCGLVQDALKVFGKMPHRDLFSWASILTAYNQADLPHRTLCLFTKMSWLDYL 102 Query: 182 KPDHFVFSTLIKACASLSNVRLGEQVH 262 KPDHFVFSTLIKACASLSNVRLGEQVH Sbjct: 103 KPDHFVFSTLIKACASLSNVRLGEQVH 129 >ref|XP_010673320.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial [Beta vulgaris subsp. vulgaris] gi|870863860|gb|KMT15007.1| hypothetical protein BVRB_3g065100 [Beta vulgaris subsp. vulgaris] Length = 610 Score = 123 bits (309), Expect = 5e-26 Identities = 53/87 (60%), Positives = 73/87 (83%) Frame = +2 Query: 2 NVLIDLYGKCGLIQDAVKVFEKMPHRDLFSWASVLTAYNQAELPHRTLCLFTKMSFLDYL 181 N L+++YGKCG+I++A+KVF++MP RD SWAS+LTAYN A LPH+TL +F M +D L Sbjct: 42 NSLVEMYGKCGVIKNALKVFDEMPQRDFISWASILTAYNHANLPHKTLFMFIDMWNVDKL 101 Query: 182 KPDHFVFSTLIKACASLSNVRLGEQVH 262 +PDHFV ++L+KAC+SL N+RLG+QVH Sbjct: 102 QPDHFVIASLVKACSSLGNIRLGKQVH 128 >ref|XP_007221312.1| hypothetical protein PRUPE_ppa026098mg [Prunus persica] gi|462417946|gb|EMJ22511.1| hypothetical protein PRUPE_ppa026098mg [Prunus persica] Length = 610 Score = 119 bits (299), Expect = 7e-25 Identities = 53/87 (60%), Positives = 70/87 (80%) Frame = +2 Query: 2 NVLIDLYGKCGLIQDAVKVFEKMPHRDLFSWASVLTAYNQAELPHRTLCLFTKMSFLDYL 181 N L+D YGKCGL++DA+ +F +MPHRD SWAS+LTA+NQA +PHRTL +F M D L Sbjct: 42 NTLLDTYGKCGLVEDALHLFGEMPHRDHVSWASILTAHNQANMPHRTLSMFPAMFESDGL 101 Query: 182 KPDHFVFSTLIKACASLSNVRLGEQVH 262 +PDHFVF++++KAC+SL VR G+QVH Sbjct: 102 QPDHFVFASVVKACSSLGAVRQGKQVH 128 >ref|XP_012078458.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial [Jatropha curcas] gi|643722900|gb|KDP32597.1| hypothetical protein JCGZ_13147 [Jatropha curcas] Length = 610 Score = 119 bits (298), Expect = 9e-25 Identities = 53/87 (60%), Positives = 70/87 (80%) Frame = +2 Query: 2 NVLIDLYGKCGLIQDAVKVFEKMPHRDLFSWASVLTAYNQAELPHRTLCLFTKMSFLDYL 181 N ++D+YGKCGL+Q A +F++MP+RD SWAS+LTAYNQA LP+RTL +F M D L Sbjct: 42 NTILDVYGKCGLLQYADYMFDEMPNRDQVSWASILTAYNQANLPNRTLSIFPNMFICDML 101 Query: 182 KPDHFVFSTLIKACASLSNVRLGEQVH 262 +PDHFV++TL+KACASL +R G+QVH Sbjct: 102 QPDHFVYATLVKACASLGAIRQGKQVH 128 >ref|XP_010251317.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g14050, mitochondrial [Nelumbo nucifera] Length = 590 Score = 119 bits (297), Expect = 1e-24 Identities = 53/87 (60%), Positives = 72/87 (82%) Frame = +2 Query: 2 NVLIDLYGKCGLIQDAVKVFEKMPHRDLFSWASVLTAYNQAELPHRTLCLFTKMSFLDYL 181 N LID+YGKCGL+Q+A+ +FE++P RD SWAS+LTAYNQA LPH+TL +F M +D L Sbjct: 22 NNLIDMYGKCGLLQEALHLFEELPQRDPVSWASILTAYNQANLPHQTLSIFPNMFAIDGL 81 Query: 182 KPDHFVFSTLIKACASLSNVRLGEQVH 262 + D+F+F+TL+KAC+SL+ V LG+QVH Sbjct: 82 QSDNFIFATLVKACSSLAAVNLGKQVH 108 >ref|XP_008222743.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial-like [Prunus mume] gi|645232177|ref|XP_008222744.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial-like [Prunus mume] Length = 610 Score = 119 bits (297), Expect = 1e-24 Identities = 52/87 (59%), Positives = 70/87 (80%) Frame = +2 Query: 2 NVLIDLYGKCGLIQDAVKVFEKMPHRDLFSWASVLTAYNQAELPHRTLCLFTKMSFLDYL 181 N L+D YGKCGL++DA+ +F++MPHRD SWAS+LTA+NQA +PHRTL +F M D L Sbjct: 42 NTLLDTYGKCGLVEDALHLFDEMPHRDHVSWASILTAHNQANMPHRTLSMFPAMFESDGL 101 Query: 182 KPDHFVFSTLIKACASLSNVRLGEQVH 262 +PDHFVF++++KAC+SL VR +QVH Sbjct: 102 QPDHFVFASVVKACSSLGAVRQAKQVH 128 >ref|XP_002298671.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550348740|gb|EEE83476.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 634 Score = 118 bits (296), Expect = 2e-24 Identities = 54/87 (62%), Positives = 71/87 (81%) Frame = +2 Query: 2 NVLIDLYGKCGLIQDAVKVFEKMPHRDLFSWASVLTAYNQAELPHRTLCLFTKMSFLDYL 181 N L+D YGKC L+QDA +F++MP RD SWAS+LTAYNQA+LP++TL +F M D L Sbjct: 66 NTLLDAYGKCNLLQDAHYLFDEMPQRDHVSWASILTAYNQAKLPNKTLSIFHYMFTTDRL 125 Query: 182 KPDHFVFSTLIKACASLSNVRLGEQVH 262 +PDHFV++TL+KACASL ++RLG+QVH Sbjct: 126 QPDHFVYATLLKACASLCSLRLGKQVH 152 >ref|XP_002520617.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223540178|gb|EEF41753.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 344 Score = 117 bits (294), Expect = 3e-24 Identities = 54/87 (62%), Positives = 69/87 (79%) Frame = +2 Query: 2 NVLIDLYGKCGLIQDAVKVFEKMPHRDLFSWASVLTAYNQAELPHRTLCLFTKMSFLDYL 181 N L++ YGKCGL+QDA +FE+MP RD SWAS+LTAYN A LP++TL +F M +D L Sbjct: 42 NTLLNAYGKCGLLQDAYFLFEEMPQRDHVSWASILTAYNLANLPNKTLSIFPTMFIVDKL 101 Query: 182 KPDHFVFSTLIKACASLSNVRLGEQVH 262 +PDHFV++TL+KACASL VR G+QVH Sbjct: 102 EPDHFVYATLVKACASLCAVRQGKQVH 128 >ref|XP_011045810.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial [Populus euphratica] Length = 634 Score = 117 bits (293), Expect = 3e-24 Identities = 54/87 (62%), Positives = 70/87 (80%) Frame = +2 Query: 2 NVLIDLYGKCGLIQDAVKVFEKMPHRDLFSWASVLTAYNQAELPHRTLCLFTKMSFLDYL 181 N L+D YGKC L+QDA +F++MP RD SWAS+LTAYNQA+LP++TL +F M D L Sbjct: 66 NTLLDAYGKCNLLQDAHYLFDEMPQRDHVSWASILTAYNQAKLPNKTLSIFHYMFTTDRL 125 Query: 182 KPDHFVFSTLIKACASLSNVRLGEQVH 262 +PDHFV++TL+KACASL +RLG+QVH Sbjct: 126 QPDHFVYATLLKACASLCALRLGKQVH 152 >ref|XP_012844493.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial-like [Erythranthe guttatus] Length = 614 Score = 115 bits (287), Expect = 2e-23 Identities = 51/87 (58%), Positives = 70/87 (80%) Frame = +2 Query: 2 NVLIDLYGKCGLIQDAVKVFEKMPHRDLFSWASVLTAYNQAELPHRTLCLFTKMSFLDYL 181 N LID+YGKCG ++ AVK+F++MP RDL SWAS+ TA+NQA P +TL LF++M D L Sbjct: 44 NALIDMYGKCGHLKHAVKLFDEMPDRDLVSWASIFTAHNQANFPRQTLFLFSRMLSRDGL 103 Query: 182 KPDHFVFSTLIKACASLSNVRLGEQVH 262 +PDHF+F++L+KACA LS +LG+Q+H Sbjct: 104 QPDHFIFASLVKACACLSASKLGQQLH 130 >gb|EYU31519.1| hypothetical protein MIMGU_mgv1a003519mg [Erythranthe guttata] Length = 580 Score = 115 bits (287), Expect = 2e-23 Identities = 51/87 (58%), Positives = 70/87 (80%) Frame = +2 Query: 2 NVLIDLYGKCGLIQDAVKVFEKMPHRDLFSWASVLTAYNQAELPHRTLCLFTKMSFLDYL 181 N LID+YGKCG ++ AVK+F++MP RDL SWAS+ TA+NQA P +TL LF++M D L Sbjct: 44 NALIDMYGKCGHLKHAVKLFDEMPDRDLVSWASIFTAHNQANFPRQTLFLFSRMLSRDGL 103 Query: 182 KPDHFVFSTLIKACASLSNVRLGEQVH 262 +PDHF+F++L+KACA LS +LG+Q+H Sbjct: 104 QPDHFIFASLVKACACLSASKLGQQLH 130 >ref|XP_006421034.1| hypothetical protein CICLE_v10004567mg [Citrus clementina] gi|557522907|gb|ESR34274.1| hypothetical protein CICLE_v10004567mg [Citrus clementina] Length = 610 Score = 115 bits (287), Expect = 2e-23 Identities = 53/87 (60%), Positives = 66/87 (75%) Frame = +2 Query: 2 NVLIDLYGKCGLIQDAVKVFEKMPHRDLFSWASVLTAYNQAELPHRTLCLFTKMSFLDYL 181 N LID YGKC L+Q A + E+MP RD SWAS+LTAYNQA LP +T+ +F+ M LD L Sbjct: 42 NTLIDAYGKCDLVQYAHHLLEEMPQRDHVSWASILTAYNQANLPQKTISIFSTMLALDKL 101 Query: 182 KPDHFVFSTLIKACASLSNVRLGEQVH 262 +PDHFVF++L+KAC SL RLG+QVH Sbjct: 102 QPDHFVFASLVKACGSLGTTRLGKQVH 128 >gb|KDO47448.1| hypothetical protein CISIN_1g037713mg [Citrus sinensis] Length = 610 Score = 114 bits (285), Expect = 3e-23 Identities = 53/87 (60%), Positives = 66/87 (75%) Frame = +2 Query: 2 NVLIDLYGKCGLIQDAVKVFEKMPHRDLFSWASVLTAYNQAELPHRTLCLFTKMSFLDYL 181 N LID YGKC L+Q A + E+MP RD SWAS+LTAYNQA LP +T+ +F+ M LD L Sbjct: 42 NTLIDAYGKCDLVQYAHHLLEEMPQRDHVSWASILTAYNQANLPQKTISIFSTMLALDKL 101 Query: 182 KPDHFVFSTLIKACASLSNVRLGEQVH 262 +PDHFVF++L+KAC SL RLG+QVH Sbjct: 102 QPDHFVFASLVKACGSLGATRLGKQVH 128 >ref|XP_006492529.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial-like isoform X2 [Citrus sinensis] Length = 610 Score = 114 bits (285), Expect = 3e-23 Identities = 53/87 (60%), Positives = 66/87 (75%) Frame = +2 Query: 2 NVLIDLYGKCGLIQDAVKVFEKMPHRDLFSWASVLTAYNQAELPHRTLCLFTKMSFLDYL 181 N LID YGKC L+Q A + E+MP RD SWAS+LTAYNQA LP +T+ +F+ M LD L Sbjct: 42 NTLIDAYGKCDLVQYAHHLLEEMPQRDHVSWASILTAYNQANLPQKTISIFSTMLALDKL 101 Query: 182 KPDHFVFSTLIKACASLSNVRLGEQVH 262 +PDHFVF++L+KAC SL RLG+QVH Sbjct: 102 QPDHFVFASLVKACGSLGATRLGKQVH 128 >ref|XP_006492528.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial-like isoform X1 [Citrus sinensis] Length = 623 Score = 114 bits (285), Expect = 3e-23 Identities = 53/87 (60%), Positives = 66/87 (75%) Frame = +2 Query: 2 NVLIDLYGKCGLIQDAVKVFEKMPHRDLFSWASVLTAYNQAELPHRTLCLFTKMSFLDYL 181 N LID YGKC L+Q A + E+MP RD SWAS+LTAYNQA LP +T+ +F+ M LD L Sbjct: 42 NTLIDAYGKCDLVQYAHHLLEEMPQRDHVSWASILTAYNQANLPQKTISIFSTMLALDKL 101 Query: 182 KPDHFVFSTLIKACASLSNVRLGEQVH 262 +PDHFVF++L+KAC SL RLG+QVH Sbjct: 102 QPDHFVFASLVKACGSLGATRLGKQVH 128 >ref|XP_011071982.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial [Sesamum indicum] Length = 611 Score = 114 bits (284), Expect = 4e-23 Identities = 53/87 (60%), Positives = 69/87 (79%) Frame = +2 Query: 2 NVLIDLYGKCGLIQDAVKVFEKMPHRDLFSWASVLTAYNQAELPHRTLCLFTKMSFLDYL 181 N L+D+YGKCG ++DAV++F++MP RDL SWAS+ TAYNQAEL TL LF+ M D L Sbjct: 43 NTLLDMYGKCGHLKDAVQLFDEMPERDLASWASIFTAYNQAELHKCTLSLFSSMLSRDGL 102 Query: 182 KPDHFVFSTLIKACASLSNVRLGEQVH 262 +PDHF+F++LI ACASL+ RLG Q+H Sbjct: 103 QPDHFIFASLINACASLAAFRLGLQLH 129 Score = 60.1 bits (144), Expect = 6e-07 Identities = 32/86 (37%), Positives = 46/86 (53%) Frame = +2 Query: 2 NVLIDLYGKCGLIQDAVKVFEKMPHRDLFSWASVLTAYNQAELPHRTLCLFTKMSFLDYL 181 N LID+Y KC + A K+F M RD+ SW S++ Q L L+ +M+ L L Sbjct: 278 NALIDMYAKCSDVLSAEKIFRNMTKRDVVSWTSIIVGMAQHGRADEALSLYNEMT-LAGL 336 Query: 182 KPDHFVFSTLIKACASLSNVRLGEQV 259 KP+ F+ LI AC+ + V G Q+ Sbjct: 337 KPNEVTFTGLIYACSHVGLVNKGRQL 362 >ref|XP_004247893.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial [Solanum lycopersicum] Length = 610 Score = 113 bits (283), Expect = 5e-23 Identities = 52/87 (59%), Positives = 71/87 (81%) Frame = +2 Query: 2 NVLIDLYGKCGLIQDAVKVFEKMPHRDLFSWASVLTAYNQAELPHRTLCLFTKMSFLDYL 181 N LID+YGKCGL+ DA+++F++M HRDL SWASV TA+N+A P +TL LF M FLD L Sbjct: 43 NNLIDMYGKCGLLDDALQLFDEMHHRDLASWASVFTAHNEANQPQKTLLLFRNM-FLDGL 101 Query: 182 KPDHFVFSTLIKACASLSNVRLGEQVH 262 +PDHFVF++++KACA+ +R+G+QVH Sbjct: 102 RPDHFVFASVVKACANSGALRVGKQVH 128 >ref|XP_009373569.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial [Pyrus x bretschneideri] Length = 610 Score = 112 bits (281), Expect = 8e-23 Identities = 49/87 (56%), Positives = 67/87 (77%) Frame = +2 Query: 2 NVLIDLYGKCGLIQDAVKVFEKMPHRDLFSWASVLTAYNQAELPHRTLCLFTKMSFLDYL 181 N L+D YGKCGL++DA +VF++MP RDL SWAS+ TA+N A +PH+T+ +F M D L Sbjct: 42 NTLLDAYGKCGLVEDARRVFDEMPQRDLVSWASIFTAHNLASVPHQTISMFPAMFESDGL 101 Query: 182 KPDHFVFSTLIKACASLSNVRLGEQVH 262 +PDHFVF+ ++KAC+ L VR G+QVH Sbjct: 102 QPDHFVFACIVKACSGLEAVRQGKQVH 128 >ref|XP_002278647.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial-like [Vitis vinifera] Length = 610 Score = 112 bits (281), Expect = 8e-23 Identities = 52/87 (59%), Positives = 67/87 (77%) Frame = +2 Query: 2 NVLIDLYGKCGLIQDAVKVFEKMPHRDLFSWASVLTAYNQAELPHRTLCLFTKMSFLDYL 181 N LI++YGKCGLIQDA+ +F ++PHRD SWAS+LTA NQA LPH TL +F M D L Sbjct: 42 NNLINMYGKCGLIQDALNLFNQLPHRDPISWASILTANNQANLPHLTLSMFPAMFKQDGL 101 Query: 182 KPDHFVFSTLIKACASLSNVRLGEQVH 262 +PDH+VF+ L+KACA L ++ G+QVH Sbjct: 102 QPDHYVFACLVKACAILGAMKQGKQVH 128 >ref|XP_008380458.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial [Malus domestica] Length = 610 Score = 111 bits (278), Expect = 2e-22 Identities = 49/87 (56%), Positives = 66/87 (75%) Frame = +2 Query: 2 NVLIDLYGKCGLIQDAVKVFEKMPHRDLFSWASVLTAYNQAELPHRTLCLFTKMSFLDYL 181 N L+D YGKCGL+++A +VF++MP RDL SWAS+ TA+N A +PHRTL + M D L Sbjct: 42 NTLLDAYGKCGLVEEARRVFDEMPQRDLVSWASIFTAHNLANVPHRTLAMLPAMFESDGL 101 Query: 182 KPDHFVFSTLIKACASLSNVRLGEQVH 262 +PDHFVF+ ++KAC+ L VR G+QVH Sbjct: 102 QPDHFVFACIVKACSGLEAVRQGKQVH 128