BLASTX nr result
ID: Gardenia21_contig00037884
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00037884 (397 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP17393.1| unnamed protein product [Coffea canephora] 69 2e-09 >emb|CDP17393.1| unnamed protein product [Coffea canephora] Length = 110 Score = 68.6 bits (166), Expect = 2e-09 Identities = 32/41 (78%), Positives = 33/41 (80%) Frame = -2 Query: 396 LKRTLYRCLMLCCCYSIIGLHFFIDLFVSDNSLFCK*KEVK 274 LK T YR LMLCCCYSIIG HF+I LFVS NS FCK KEVK Sbjct: 70 LKMTFYRRLMLCCCYSIIGRHFYIHLFVSANSFFCKLKEVK 110