BLASTX nr result
ID: Gardenia21_contig00037831
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00037831 (387 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP19152.1| unnamed protein product [Coffea canephora] 107 5e-21 >emb|CDP19152.1| unnamed protein product [Coffea canephora] Length = 1182 Score = 107 bits (266), Expect = 5e-21 Identities = 52/59 (88%), Positives = 54/59 (91%) Frame = -3 Query: 178 FSAAGSTLNMEEYEQPHGNMPELALGLAPSEGPVLSLQAEHRSSDIEKGKDLAPLTCRR 2 F GSTLNMEE+EQ HGN+PELALGLA SEGPVLSLQAEHRSSDIEKGKDLAPLTCRR Sbjct: 32 FILVGSTLNMEEHEQTHGNLPELALGLASSEGPVLSLQAEHRSSDIEKGKDLAPLTCRR 90