BLASTX nr result
ID: Gardenia21_contig00037752
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00037752 (481 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP05175.1| unnamed protein product [Coffea canephora] 64 4e-08 ref|XP_012852019.1| PREDICTED: uncharacterized protein LOC105971... 60 5e-07 ref|XP_009785119.1| PREDICTED: uncharacterized protein LOC104233... 59 1e-06 ref|XP_002269597.1| PREDICTED: uncharacterized protein LOC100252... 58 3e-06 gb|KJB44549.1| hypothetical protein B456_007G259000 [Gossypium r... 56 9e-06 ref|XP_012486507.1| PREDICTED: uncharacterized protein LOC105800... 56 9e-06 gb|AFK37681.1| unknown [Lotus japonicus] 56 9e-06 >emb|CDP05175.1| unnamed protein product [Coffea canephora] Length = 251 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/31 (96%), Positives = 30/31 (96%), Gaps = 1/31 (3%) Frame = -1 Query: 481 WCFNLFGFLLPVYLPKAFKIYY-SSVRKAKD 392 WCFNLFGFLLPVYLPKAFKIYY SSVRKAKD Sbjct: 221 WCFNLFGFLLPVYLPKAFKIYYSSSVRKAKD 251 >ref|XP_012852019.1| PREDICTED: uncharacterized protein LOC105971696 [Erythranthe guttatus] gi|604306054|gb|EYU25111.1| hypothetical protein MIMGU_mgv1a021062mg [Erythranthe guttata] Length = 247 Score = 60.5 bits (145), Expect = 5e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 481 WCFNLFGFLLPVYLPKAFKIYYSSVRKAKD 392 WCFNLFGFLLPV+LPKAFKIYY S+ K KD Sbjct: 218 WCFNLFGFLLPVFLPKAFKIYYHSISKIKD 247 >ref|XP_009785119.1| PREDICTED: uncharacterized protein LOC104233421 [Nicotiana sylvestris] Length = 240 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 481 WCFNLFGFLLPVYLPKAFKIYYSSVRKAKD 392 WCFNLFGFLLPVYLPKAFKIYYS+ RK KD Sbjct: 212 WCFNLFGFLLPVYLPKAFKIYYSA-RKLKD 240 >ref|XP_002269597.1| PREDICTED: uncharacterized protein LOC100252463 [Vitis vinifera] Length = 256 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -1 Query: 481 WCFNLFGFLLPVYLPKAFKIYYSSVRKAKD 392 WCFNLFGFLLPVYLP+AFK YY+S K KD Sbjct: 227 WCFNLFGFLLPVYLPRAFKKYYASFNKIKD 256 >gb|KJB44549.1| hypothetical protein B456_007G259000 [Gossypium raimondii] Length = 74 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -1 Query: 481 WCFNLFGFLLPVYLPKAFKIYYSSVRKAKD 392 WCFNLFGFLLPVYLPKAFK+YYS K KD Sbjct: 46 WCFNLFGFLLPVYLPKAFKMYYSET-KVKD 74 >ref|XP_012486507.1| PREDICTED: uncharacterized protein LOC105800125 [Gossypium raimondii] gi|763770084|gb|KJB37299.1| hypothetical protein B456_006G198600 [Gossypium raimondii] Length = 239 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -1 Query: 481 WCFNLFGFLLPVYLPKAFKIYYSSVRKAKD 392 WCFNLFGFLLPVYLPKAFK+YYS K KD Sbjct: 211 WCFNLFGFLLPVYLPKAFKMYYSET-KVKD 239 >gb|AFK37681.1| unknown [Lotus japonicus] Length = 248 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 481 WCFNLFGFLLPVYLPKAFKIYYSSVRKAKD 392 WCFNLFGFLLPVYLPKAFK+YY SV K K+ Sbjct: 220 WCFNLFGFLLPVYLPKAFKLYY-SVHKEKE 248