BLASTX nr result
ID: Gardenia21_contig00037491
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00037491 (1410 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP14840.1| unnamed protein product [Coffea canephora] 93 2e-26 >emb|CDP14840.1| unnamed protein product [Coffea canephora] Length = 104 Score = 92.8 bits (229), Expect(3) = 2e-26 Identities = 46/55 (83%), Positives = 46/55 (83%) Frame = -3 Query: 973 VG*KIRSTFLLSLIPLSADTAVVASLCCYPLPQQPSSFCFKSPPAAIGAVVLIQK 809 VG KIRS FLLSLIP SADT VAS CCYPLPQQPS FCFK PPAAIG VVLIQK Sbjct: 28 VGWKIRSAFLLSLIPPSADTVAVASFCCYPLPQQPSFFCFKYPPAAIGTVVLIQK 82 Score = 40.8 bits (94), Expect(3) = 2e-26 Identities = 18/23 (78%), Positives = 22/23 (95%) Frame = -2 Query: 812 EDIDLNSLMLNFFIWVARVKQAV 744 +DIDLNSLM+NF IW+ARV+QAV Sbjct: 82 KDIDLNSLMVNFSIWLARVEQAV 104 Score = 35.4 bits (80), Expect(3) = 2e-26 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 Query: 1011 MDKWWLIRMSDSEW 970 MDKWWLIRM DSEW Sbjct: 1 MDKWWLIRMLDSEW 14