BLASTX nr result
ID: Gardenia21_contig00037350
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00037350 (257 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP09578.1| unnamed protein product [Coffea canephora] 104 2e-20 ref|XP_010065040.1| PREDICTED: putative UPF0481 protein At3g0264... 57 5e-06 gb|KCW70767.1| hypothetical protein EUGRSUZ_F03927 [Eucalyptus g... 57 5e-06 >emb|CDP09578.1| unnamed protein product [Coffea canephora] Length = 569 Score = 104 bits (260), Expect = 2e-20 Identities = 54/75 (72%), Positives = 59/75 (78%) Frame = +3 Query: 3 SHKRATVLDYLEDLDKEDFIKLVEGSPEDFEPKIRSCYDRYLDLDKEALAWVVIVDGLFL 182 S KRA VLDYL+ LD E F KLV+ PEDFEPKIRSCYDRYLDLDKE LAWVVIVDGLF Sbjct: 91 SDKRAAVLDYLKALDDEHFSKLVKEGPEDFEPKIRSCYDRYLDLDKETLAWVVIVDGLF- 149 Query: 183 LDLIDYLGSEEPNKN 227 LI YLG+ + K+ Sbjct: 150 --LIHYLGNGDVGKS 162 >ref|XP_010065040.1| PREDICTED: putative UPF0481 protein At3g02645 [Eucalyptus grandis] Length = 548 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/70 (38%), Positives = 44/70 (62%) Frame = +3 Query: 6 HKRATVLDYLEDLDKEDFIKLVEGSPEDFEPKIRSCYDRYLDLDKEALAWVVIVDGLFLL 185 +K A V Y + L++ F LVE + EP++R+CY +YLD + E LAW++++D LFLL Sbjct: 83 YKLAAVKRYQKQLERIKFQSLVEQLVK-LEPRVRACYHKYLDFNGETLAWMMVIDALFLL 141 Query: 186 DLIDYLGSEE 215 + + +E Sbjct: 142 EFLQIYAIKE 151 >gb|KCW70767.1| hypothetical protein EUGRSUZ_F03927 [Eucalyptus grandis] Length = 534 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/70 (38%), Positives = 44/70 (62%) Frame = +3 Query: 6 HKRATVLDYLEDLDKEDFIKLVEGSPEDFEPKIRSCYDRYLDLDKEALAWVVIVDGLFLL 185 +K A V Y + L++ F LVE + EP++R+CY +YLD + E LAW++++D LFLL Sbjct: 54 YKLAAVKRYQKQLERIKFQSLVEQLVK-LEPRVRACYHKYLDFNGETLAWMMVIDALFLL 112 Query: 186 DLIDYLGSEE 215 + + +E Sbjct: 113 EFLQIYAIKE 122