BLASTX nr result
ID: Gardenia21_contig00037341
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00037341 (232 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP12527.1| unnamed protein product [Coffea canephora] 60 8e-07 >emb|CDP12527.1| unnamed protein product [Coffea canephora] Length = 530 Score = 59.7 bits (143), Expect = 8e-07 Identities = 34/64 (53%), Positives = 41/64 (64%), Gaps = 4/64 (6%) Frame = -2 Query: 183 CKGPVISK-SPLYTDTGSRIAKNSSFSFEGYP---YNYVVVGRNVVASDIRENCTITRIA 16 CK PV SK PLY DT S + FS P Y+YVVVG+NVVASDI E+CT+ + A Sbjct: 15 CKNPVKSKYPPLYVDTASCNISANHFSKMKAPSNNYSYVVVGKNVVASDIEESCTVYKTA 74 Query: 15 PIQL 4 P+ L Sbjct: 75 PVDL 78