BLASTX nr result
ID: Gardenia21_contig00037195
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00037195 (270 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO97560.1| unnamed protein product [Coffea canephora] 82 2e-13 ref|XP_010657685.1| PREDICTED: dnaJ homolog subfamily B member 4... 58 3e-06 emb|CBI23775.3| unnamed protein product [Vitis vinifera] 58 3e-06 >emb|CDO97560.1| unnamed protein product [Coffea canephora] Length = 371 Score = 81.6 bits (200), Expect = 2e-13 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = +1 Query: 1 PISKQHGRRGELRLRFLVEFPTDLSEQQRSAVVRILEDCC 120 PISKQHGRRG+LRLRFLVEFPTDLS+QQRSAVVRILEDCC Sbjct: 332 PISKQHGRRGDLRLRFLVEFPTDLSKQQRSAVVRILEDCC 371 >ref|XP_010657685.1| PREDICTED: dnaJ homolog subfamily B member 4 [Vitis vinifera] Length = 415 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/38 (65%), Positives = 34/38 (89%) Frame = +1 Query: 1 PISKQHGRRGELRLRFLVEFPTDLSEQQRSAVVRILED 114 P++KQ GRRG+L+++FLV FPT+LS+QQRS V RIL+D Sbjct: 376 PMAKQEGRRGDLKIKFLVSFPTELSDQQRSDVYRILQD 413 >emb|CBI23775.3| unnamed protein product [Vitis vinifera] Length = 316 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/38 (65%), Positives = 34/38 (89%) Frame = +1 Query: 1 PISKQHGRRGELRLRFLVEFPTDLSEQQRSAVVRILED 114 P++KQ GRRG+L+++FLV FPT+LS+QQRS V RIL+D Sbjct: 277 PMAKQEGRRGDLKIKFLVSFPTELSDQQRSDVYRILQD 314